| Catalog number: | C249 |
|---|---|
| Price: | 485 € |
| Supplier: | acr |
| Product name: | Recombinant Human Phosphomannomutase 1, PMM1 (C-6His) |
| Quantity: | 50 Вµg |
| Other quantities: | 1 mg 2283€ 10 µg 202€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Phosphomannomutase 1 is produced by our E, coli expression system and the target gene encoding Met1-Ala262 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 30, 8 kD |
| UniProt number: | Q92871 |
| State of the product: | Liquid |
| Shipping conditions: | Dry ice/ice packs |
| Formulation: | 1 mM DTT, 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEAVEHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | PMM1 (C-6His), Phosphomannomutase 1 |
| Short name: | PMM1 (C-6His), Recombinant Phosphomannomutase 1 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | PMM1 (C-6His), sapiens Phosphomannomutase 1, recombinant H |
| Alternative technique: | rec |
| Identity: | 9114 |
| Gene: | PMM1 | More about : PMM1 |
| Long gene name: | phosphomannomutase 1 |
| Synonyms: | Sec53 |
| Synonyms name: | brain glucose-1, 6-bisphosphatase |
| Locus: | 22q13, 2 |
| Discovery year: | 1996-10-02 |
| Entrez gene record: | 5372 |
| Pubmed identfication: | 9070917 9271215 |
| RefSeq identity: | NM_002676 |
| Classification: | HAD Asp-based non-protein phosphatases |
| Havana BLAST/BLAT: | OTTHUMG00000150972 |
| C249 | Recombinant Human Phosphomannomutase 1, PMM1 (C-6His) | 500 µg | 1613 € | novo | human |
| AE26859HU-48 | ELISA test for Human Phosphomannomutase 1 (PMM1) | 1x plate of 48 wells | 373 € | abebio | human |
| AE26859HU-96 | Human Phosphomannomutase 1 (PMM1) ELISA Kit | 1x plate of 96 wells | 612 € | abebio | human |
| GENTAUR-58ba369a18d44 | Candida albicans Phosphomannomutase (PMM1) | 100ug | 1746 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba369acdd7d | Candida albicans Phosphomannomutase (PMM1) | 1000ug | 1746 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba369b512cd | Candida albicans Phosphomannomutase (PMM1) | 100ug | 2260 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba369bacd34 | Candida albicans Phosphomannomutase (PMM1) | 1000ug | 2260 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba37055dca8 | Candida albicans Phosphomannomutase (PMM1) | 100ug | 1746 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba3705b9728 | Candida albicans Phosphomannomutase (PMM1) | 1000ug | 1746 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba37064c155 | Candida albicans Phosphomannomutase (PMM1) | 100ug | 2260 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba3706de018 | Candida albicans Phosphomannomutase (PMM1) | 1000ug | 2260 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb0fdd22aec | Mouse Phosphomannomutase 1 (Pmm1) | 100ug | 1768 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb0fdd6af4c | Mouse Phosphomannomutase 1 (Pmm1) | 1000ug | 1768 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb0fddaf554 | Mouse Phosphomannomutase 1 (Pmm1) | 100ug | 2282 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb0fdde6169 | Mouse Phosphomannomutase 1 (Pmm1) | 1000ug | 2282 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb3b5727daa | Mouse Phosphomannomutase 1 (Pmm1) | 100ug | 1768 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb3b5767e60 | Mouse Phosphomannomutase 1 (Pmm1) | 1000ug | 1768 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb3b57b33ba | Mouse Phosphomannomutase 1 (Pmm1) | 100ug | 2282 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bb3b5805023 | Mouse Phosphomannomutase 1 (Pmm1) | 1000ug | 2282 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bd63531a798 | Schizosaccharomyces pombe Phosphomannomutase (pmm1) | 100ug | 1763 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd635357dae | Schizosaccharomyces pombe Phosphomannomutase (pmm1) | 1000ug | 1763 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd6353a736f | Schizosaccharomyces pombe Phosphomannomutase (pmm1) | 100ug | 2277 € | MBS Recombinant Proteins | human |
| GENTAUR-58bd6353f2ee4 | Schizosaccharomyces pombe Phosphomannomutase (pmm1) | 1000ug | 2277 € | MBS Recombinant Proteins | human |
| C250 | Recombinant Human Phosphomannomutase 2, PMM2 (C-6His) | 500 µg | 1613 € | novo | human |
| GWB-P1256H | PMM1, 1-262aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| RP-1235H | Recombinant Human Phosphomannomutase 2 / PMM2 / CDG1 Protein (His Tag) | 20μg | 456 € | adv | human |
| GWB-BSP283 | PMM1 Human Protein | bulk | Ask price € | genways bulk | human |
| LV266557 | PMM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| AR09721PU-L | anti-PMM1 (1-262, His-tag) Antibody | 0,25 mg | 1138 € | acr | human |
| AR09721PU-N | anti-PMM1 (1-262, His-tag) Antibody | 50 Вµg | 485 € | acr | human |