Recombinant Human Phosphomannomutase 1, PMM1 (C-6His)

Catalog number:	C249 Buy Now
Price:	485 €
Supplier:	acr
Product name:	Recombinant Human Phosphomannomutase 1, PMM1 (C-6His)
Quantity:	50 Вµg
Other quantities:	1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:	human pmm sapiens chis synonyms produced

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Phosphomannomutase 1 is produced by our E, coli expression system and the target gene encoding Met1-Ala262 is expressed with a 6His tag at the C-terminus
Molecular Weight:	30, 8 kD
UniProt number:	Q92871
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	1 mM DTT, 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEAVEHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	PMM1 (C-6His), Phosphomannomutase 1
Short name:	PMM1 (C-6His), Recombinant Phosphomannomutase 1
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	PMM1 (C-6His), sapiens Phosphomannomutase 1, recombinant H
Alternative technique:	rec
Identity:	9114
Gene:	PMM1 | More about : PMM1
Long gene name:	phosphomannomutase 1
Synonyms:	Sec53
Synonyms name:	brain glucose-1, 6-bisphosphatase
Locus:	22q13, 2
Discovery year:	1996-10-02
Entrez gene record:	5372
Pubmed identfication:	9070917 9271215
RefSeq identity:	NM_002676
Classification:	HAD Asp-based non-protein phosphatases
Havana BLAST/BLAT:	OTTHUMG00000150972

• #human
• #pmm
• #sapiens
• #chis
• #synonyms
• #produced