Recombinant Human Oncomodulin-1, OM (N-6His)

Catalog number:	C245 Buy Now
Price:	1613 €
Supplier:	novo
Product name:	Recombinant Human Oncomodulin-1, OM (N-6His)
Quantity:	500 µg
Other quantities:	50 µg 496€
Related search:	human recombinant sapiens nhis alternative

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Oncomodulin-1 is produced by our E, coli expression system and the target gene encoding Met1-Ser109 is expressed with a 6His tag at the N-terminus
Molecular Weight:	14, 3 kD
UniProt number:	P0CE72
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	100 mM sodium chloride, pH 7, 2 um filtered solution of 50 mM Tris, 5, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MGSSHHHHHHSSGLVPRGSHMSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	OM (N-6His), Oncomodulin-1
Short name:	OM (N-6His), Recombinant Oncomodulin-1
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	OM (N-6His), sapiens Oncomodulin-1, recombinant H
Alternative technique:	rec

• #human
• #recombinant
• #sapiens
• #nhis
• #alternative