| Catalog number: | C238 |
|---|---|
| Price: | 1500 € |
| Supplier: | acr |
| Product name: | Recombinant Human Myelin P2 Protein, PMP2 (N-6His) |
| Quantity: | 0,5 mg |
| Other quantities: | 10 µg 202€ 50 µg 496€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Myelin P2 protein is produced by our E, coli expression system and the target gene encoding Met1-Val132 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: | 07 kD, 17 |
| UniProt number: | P02689 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MGSSHHHHHHSSGLVPRGSHMSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | PMP2 (N-6His), Myelin P2 Protein |
| Short name: | PMP2 (N-6His), Recombinant Myelin P2 Protein |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | PMP2 (N-6His), sapiens Myelin P2 Protein, recombinant H |
| Alternative technique: | rec |
| Identity: | 9117 |
| Gene: | PMP2 | More about : PMP2 |
| Long gene name: | peripheral myelin protein 2 |
| Synonyms: | MP2 FABP8 M-FABP |
| Locus: | 8q21, 13 |
| Discovery year: | 1992-11-10 |
| GenBank acession: | X62167 |
| Entrez gene record: | 5375 |
| Pubmed identfication: | 1720307 8288226 |
| RefSeq identity: | NM_002677 |
| Classification: | Fatty acid binding protein family |
| Havana BLAST/BLAT: | OTTHUMG00000164600 |
| MBS617497 | Myelin Protein Zero (MPZ, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Glycoprotein P-Zero, Myelin P0 Protein Precursor, Myelin Peripheral Protein, Myelin Protein Peripheral, MPP, Myelin Protein Zero (Charcot-Marie-Tooth Neuropathy 1 Antibody | 0.25 ml | 669 € | MBS Polyclonals_1 | human |
| C238 | Recombinant Human Myelin P2 Protein, PMP2 (N-6His) | 500 µg | 1613 € | novo | human |
| GENTAUR-58b8e7013ea1d | Bovine Myelin P2 protein (PMP2) | 100ug | 1448 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b8e701d2945 | Bovine Myelin P2 protein (PMP2) | 1000ug | 1448 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b8e70240b23 | Bovine Myelin P2 protein (PMP2) | 100ug | 1951 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b8e702a798d | Bovine Myelin P2 protein (PMP2) | 1000ug | 1951 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9e32ad1576 | Bovine Myelin P2 protein (PMP2) | 100ug | 1448 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9e32b3502f | Bovine Myelin P2 protein (PMP2) | 1000ug | 1448 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9e32ba9ff5 | Bovine Myelin P2 protein (PMP2) | 100ug | 1951 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58b9e32c1e872 | Bovine Myelin P2 protein (PMP2) | 1000ug | 1951 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58bc3e02c70f8 | Horse Myelin P2 protein (PMP2) | 100ug | 1448 € | MBS Recombinant Proteins | horse |
| GENTAUR-58bc3e031e194 | Horse Myelin P2 protein (PMP2) | 1000ug | 1448 € | MBS Recombinant Proteins | horse |
| GENTAUR-58bc3e0370150 | Horse Myelin P2 protein (PMP2) | 100ug | 1951 € | MBS Recombinant Proteins | horse |
| GENTAUR-58bc3e03b8124 | Horse Myelin P2 protein (PMP2) | 1000ug | 1951 € | MBS Recombinant Proteins | horse |
| GENTAUR-58ba3ae53395d | Pig Myelin P2 protein (PMP2) | 100ug | 1448 € | MBS Recombinant Proteins | pig |
| GENTAUR-58ba3ae5cf955 | Pig Myelin P2 protein (PMP2) | 1000ug | 1448 € | MBS Recombinant Proteins | pig |
| GENTAUR-58ba3ae64c8a4 | Pig Myelin P2 protein (PMP2) | 100ug | 1951 € | MBS Recombinant Proteins | pig |
| GENTAUR-58ba3ae6b40e7 | Pig Myelin P2 protein (PMP2) | 1000ug | 1951 € | MBS Recombinant Proteins | pig |
| GENTAUR-58b8713b8dd0c | Rabbit Myelin P2 protein (PMP2) | 100ug | 1448 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8713bda6d6 | Rabbit Myelin P2 protein (PMP2) | 1000ug | 1448 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8713c540f2 | Rabbit Myelin P2 protein (PMP2) | 100ug | 1951 € | MBS Recombinant Proteins | human |
| GENTAUR-58b8713cb40d5 | Rabbit Myelin P2 protein (PMP2) | 1000ug | 1951 € | MBS Recombinant Proteins | human |
| CI85 | Recombinant Human Myelin Protein P0-like 1, MPZL1 (C-6His) | 500 µg | 709 € | novo | human |
| C802 | Recombinant Human Myelin Protein P0, MPZ (C-6His) | 50 µg | 496 € | novo | human |
| C897 | Recombinant Human Myelin-Associated Glycoprotein, MAG, Siglec-4a (C-6His) | 50 µg | 369 € | novo | human |
| C565 | Recombinant Human Myelin Oligodendrocyte Glycoprotein, MOG (C-6His) | 50 µg | 369 € | novo | human |
| RP-1236H | Recombinant Human PMP2 / FABP8 Protein (His Tag) | 20μg | 572 € | adv | human |
| GWB-P0203H | PMP2, 1-132aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| LV266569 | PMP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| AR09022PU-L | anti-PMP2 (1-132) Antibody | 0,5 mg | 1500 € | acr | human |