Recombinant Human LMW-PTP, ACP1 (C-6His)

Contact us
Catalog number: C201
Price: 354 €
Supplier: MBS mono
Product name: Recombinant Human LMW-PTP, ACP1 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LMW-PTP is produced by our E, coli expression system and the target gene encoding Ala2-His158 is expressed with a 6His tag at the C-terminus
Molecular Weight: 04 kD, 19
UniProt number: P24666
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ACP1 (C-6His), LMW-PTP
Short name: ACP1 (C-6His), Recombinant LMW-PTP
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ACP1 (C-6His), sapiens LMW-PTP, recombinant H
Alternative technique: rec
Identity: 122
Gene: ACP1 | More about : ACP1
Long gene name: acid phosphatase 1, soluble
Synonyms: HAAP LMW-PTP LMWPTP
Synonyms name: acid phosphatase of erythrocyte low molecular weight phosphotyrosine protein phosphatase red cell acid phosphatase
Locus: 2p25, 3
Discovery year: 1986-01-01
GenBank acession: M87546
Entrez gene record: 52
Pubmed identfication: 457131 1587862 8586411
RefSeq identity: NM_004300
Classification: Acid phosphatases Class II Cys-based phosphatases
Havana BLAST/BLAT: OTTHUMG00000086933

Related Products :

C201 Recombinant Human LMW-PTP, ACP1 (C-6His) 1 mg 2283 € novo human
RP-0012H Recombinant Human ACP1 / LMW-PTP Protein (GST Tag) 20μg 456 € adv human
AR09161PU-L anti-ACP1 / LMW-PTPase (1-158, His-tag) Antibody 0,5 mg 1500 € acr human
AR09161PU-N anti-ACP1 / LMW-PTPase (1-158, His-tag) Antibody 0,1 mg 587 € acr human
AM50647PU-N anti-ACP1 / LMW-PTPase Antibody 0,1 ml 500 € acr human
AM50647PU-S anti-ACP1 / LMW-PTPase Antibody 50 Вµl 369 € acr human
AP05058PU-N anti-ACP1 / LMW-PTPase Antibody 0,1 mg 587 € acr human
AP50056PU-N anti-ACP1 / LMW-PTPase (N-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58b9bbd883adf Cysteine proteinase ACP1 (ACP1) 100ug 1658 € MBS Recombinant Proteins human
GENTAUR-58b9bbd8db54f Cysteine proteinase ACP1 (ACP1) 1000ug 1658 € MBS Recombinant Proteins human
GENTAUR-58b9bbd93b3d4 Cysteine proteinase ACP1 (ACP1) 100ug 2166 € MBS Recombinant Proteins human
GENTAUR-58b9bbd979c22 Cysteine proteinase ACP1 (ACP1) 1000ug 2166 € MBS Recombinant Proteins human
GWB-P0071F PTP-1B(Protein Tyrosine Phosphatase1B), Human, Recombinant Protein bulk Ask price € genways bulk human
GWB-PS65D2 PTP-D2/PTPN14, Active Human recombinant protein 1 vial 470 € genways human
RP-1282H Recombinant Human PTPN2 / TC-PTP Protein (aa 1-314, His & GST Tag) 50μg 624 € adv human
RP-1467M Recombinant Mouse PTPN2 / TC-PTP Protein (aa 2-314, His Tag) 50μg 624 € adv mouse
KINL15-N-50 Kininogen, LMW, Human Plasma 50 μg 260 € adi human
GENTAUR-58bde82e24d73 Mouse Monoclonal [clone AE1] (IgG1) to Human Keratin, LMW Antibody 0.25 ml 597 € MBS mono human
YM5033 Urokinase (NON-Inhibitory), HMW-scuPA (54kD), HMW-tsuPA (52kD), LMW-scuPA (33kD), Clone: PGM2005, Mouse Monoclonal antibody-Human 1000ul 541 € accurate-monoclonals human
LV067302 ACP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV067303 ACP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV067304 ACP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV067305 ACP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV067307 ACP1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV067306 ACP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
AM33197SU-N anti-Cytokeratin 18 (CK-LMW) Antibody 1 ml 1413 € acr human
AM33197SU-S anti-Cytokeratin 18 (CK-LMW) Antibody 0,1 ml 601 € acr human
AP21467SU-N anti-Kininogen-1 (LMW Isoform) Antibody 1 ml 601 € acr human
83-936 CALIBRATION KIT LMW FOR ELECTR 10/Unit 378 € Genesee 02 human
GENTAUR-58be218533013 Cytokeratin, Acidic (Type I or LMW) 100ug 354 € MBS mono human