| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Nucleolar Protein 3 is produced by our E, coli expression system and the target gene encoding Met1-Ser208 is expressed with a GST tag at the N-terminus |
| Molecular Weight: |
48, 92 kD |
| UniProt number: |
O60936 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM DTT, 2 um filtered solution of 20 mM TrisHCl, 350 mM sodium chloride, Lyophilized from a 0, pH 8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
NOL3 (N-GST), Nucleolar Protein 3 |
| Short name: |
NOL3 (N-GST), Recombinant Nucleolar Protein 3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
nucleolar protein 3 (apoptosis repressor with CARD domain) (N-GST), sapiens Nucleolar Protein 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ARC and FCM and MYP and NOP and NOP30, NOL3 and IDBG-36117 and ENSG00000140939 and 8996, NOL3 and IDBG-633333 and ENSBTAG00000003519 and 515777, Nol3 and IDBG-187078 and ENSMUSG00000014776 and 78688, identical protein binding, nuclei, this GO :0001666 and response to hypoxia and biological process this GO :0003723 and RNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0006397 and mRNA processing and biological process this GO :0006915 and apoptotic process and biological process this GO :0008380 and RNA splicing and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0014876 and response to injury involved in regulation of muscle adaptation and biological process this GO :0016528 and sarcoplasm and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process, this GO :0003723 : RNA binding, this GO :0003723 : RNA binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, nucleolar protein 3 (apoptosis repressor with CARD domain) |
| Identity: |
7869 |
| Gene: |
NOL3 |
More about : NOL3 |
| Long gene name: |
nucleolar protein 3 |
| Synonyms gene name: |
nucleolar protein 3 (apoptosis repressor with CARD domain) |
| Synonyms: |
ARC NOP30 MYP CARD2 |
| Locus: |
16q22, 1 |
| Discovery year: |
1999-01-13 |
| GenBank acession: |
AF043244 |
| Entrez gene record: |
8996 |
| Pubmed identfication: |
9560245 |
| Classification: |
Caspase recruitment domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000173316 |