Recombinant Human Tumor Necrosis Factor β, TNFβ

Contact us
Catalog number: C181
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human Tumor Necrosis Factor β, TNFβ
Quantity: bulk
Other quantities: 1 mg 1836€ 10 µg 168€ 500 µg 1298€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Tumor Necrosis Factor beta is produced by our E, coli expression system and the target gene encoding Leu35-Leu205 is expressed
Molecular Weight: 18, 8 kD
UniProt number: P01374
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TNF&beta, Tumor Necrosis Factor &beta
Short name: TNF&beta, Recombinant Tumor Necrosis Factor &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: TNF&beta, sapiens Tumor Necrosis Factor &beta, recombinant H
Alternative technique: rec
Identity: 11892
Gene: TNF | More about : TNF
Long gene name: tumor necrosis factor
Synonyms gene: TNFA
Synonyms gene name: member 2) , tumor necrosis factor (TNF superfamily
Synonyms: TNFSF2 DIF TNF-alpha
Synonyms name: TNF superfamily, member 2
Locus: 6p21, 33
Discovery year: 1986-01-01
GenBank acession: X02910
Entrez gene record: 7124
Pubmed identfication: 2413547 6392892
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000031194

Related Products :

C181 Recombinant Human Tumor Necrosis Factor β, TNFβ 50 µg 405 € novo human
MBS617120 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) 100ug 868 € MBS Polyclonals_1 human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS620184 TNF Receptor, Extracellular Domain p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) Antibody 1000ug 685 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
abx260655 Anti-Tumor Necrosis Factor beta , His Tag Protein (Recombinant) 1 mg 4675 € abbex human
abx167666 Anti-Tumor Necrosis Factor beta Protein (Recombinant) 100 μg 891 € abbex human
abx260712 Anti-Tumor Necrosis Factor beta Protein (Recombinant) 1 mg 3559 € abbex human
E-EL-C0230 Canine TNF-β (Tumor Necrosis Factor Beta) ELISA Kit 96T 624 € elabsciences human
TNFA15-R-10 Recombinant (E.Coli) purified human Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 10 μg 260 € adi human
TNFA16-R-10 Recombinant (E.Coli) purified human Tumor Necrosis Factor-Alpha Variant (TNF-alpha variant, 151-aa), biologically active 10 μg 260 € adi human
GWB-5B3B2C Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 1 bulk Ask price € genways bulk human
GWB-96D488 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 3 bulk Ask price € genways bulk human
GWB-CE46DD Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 6 bulk Ask price € genways bulk human
GWB-E92EF9 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 7 bulk Ask price € genways bulk human
C036 Recombinant Human Tumor Necrosis Factor-α, TNF-α High Active Mutant 10 µg 151 € novo human
C008 Recombinant Human Tumor Necrosis Factor α, TNFα 1 mg 963 € novo human
CG90 Recombinant Human Tumor Necrosis Factor α, TNFα (C-6His) 10 µg 95 € novo human
CG91 Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His) 1 mg 2486 € novo human
RP-1796H Recombinant Human Tumor Necrosis Factor-alpha/TNFSF2 Protein 50µg 282 € adv human
CP04 Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (C-Fc) 1 mg 2283 € novo human
C689 Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His) 10 µg 156 € novo human
CI39 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His) 500 µg 1613 € novo human
CP11 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-Fc) 500 µg 1613 € novo human
C782 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (Lys288-Ser461, C-6His) 10 µg 156 € novo human
CU04 Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (C-Fc-Avi) 50 µg 278 € novo human
GWB-703B3C Recombinant Human Tumor Necrosis Factor Receptor Type 1 bulk Ask price € genways bulk human
GWB-1FE029 Recombinant Human Tumor Necrosis Factor Receptor Type 1 His Tag bulk Ask price € genways bulk human