Recombinant Human Transforming Growth Factor α, TGFα

Contact us
Catalog number: C178
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Transforming Growth Factor α, TGFα
Quantity: 1 mg
Other quantities: 10 µg 90€ 50 µg 171€ 500 µg 831€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Transforming Growth Factor alpha is produced by our E, coli expression system and the target gene encoding Val41-Val90 is expressed
Molecular Weight: 5, 55 kD
UniProt number: P01135
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 10 mM Acetic Acid , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TGF&alpha, Transforming Growth Factor &alpha
Short name: TGF&alpha, Recombinant Transforming Growth Factor &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: TGF&alpha, sapiens Transforming Growth Factor &alpha, recombinant H
Alternative technique: rec

Related Products :

C178 Recombinant Human Transforming Growth Factor α, TGFα 1 mg 1166 € novo human
AE17173SH-48 ELISA test for Sheep Transforming growth factor α (TGFα) 1x plate of 48 wells 402 € abebio human
AE17173SH Sheep Transforming growth factor α (TGFα) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE17173SH-96 Sheep Transforming growth factor α (TGFα) ELISA Kit 1x plate of 96 wells 671 € abebio human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS618947 Transforming Growth Factor beta2 Receptor (16CT) (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) 200ug 658 € MBS Polyclonals_1 human
MBS612691 Transforming Growth Factor beta2 Receptor (28NT) (TGFb2R, TGFBR2, Transforming Growth Factor beta Receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) Antibody 200ug 608 € MBS Polyclonals_1 human
MBS621744 Transforming Growth Factor beta3 (Transforming Growth Factor beta 3, TGF beta 3, TGF beta3, TGFb3, ARVD, FLJ16571) Antibody 500ul 713 € MBS Polyclonals_1 human
MBS621901 SHC-Transforming Protein 2 (Src Homology 2 Domain-Containing-Transforming Protein C2, SH2 Domain Protein C2, SHC-Transforming Protein B, Protein Sck, SHC2, SCK, SHCB) 100ug 752 € MBS Polyclonals_1 human
MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human
TGFA15-R-100 Human Recombinant Transforming Growth Factor-alpha (TGF-alpha), biologically active 100 μg 623 € adi human
TGFA15-R-1000 Human Recombinant Transforming Growth Factor-alpha (TGF-alpha), biologically active 1000 μg 4183 € adi human
TGFA15-R-20 Human Recombinant Transforming Growth Factor-alpha (TGF-alpha), biologically active 20 μg 260 € adi human
MBS622371 TGF beta-induced Factor 2 (Transforming Growth Factor beta-induced Factor 2, TGF (beta)-induced Transcription Factor 2, TGFB-induced Factor 2, TGIF2, 5'-TG-3' Interacting Factor 2, 5'-TG-3'-interacting Factor 2, Homeobox Protein TGIF2) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS623133 bTransforming Growth Factor beta2 Receptor (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human
MBS624351 CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS624298 Fibroblast Growth Factor, Basic (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) (Biotin) Antibody 50ug 763 € MBS Polyclonals_1 human
MBS623388 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624013 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ul 696 € MBS Polyclonals_1 human
RP-979 Recombinant (E.Coli) Human Transforming Growth Factor Beta Induced protein 5 μg 188 € adi human
GWB-F63311 Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.) bulk Ask price € genways bulk human
GWB-722DA1 Recombinant Human Transforming Growth Factor-Beta 1 His Tag bulk Ask price € genways bulk human
CA59 Recombinant Human Transforming Growth Factor β-1, TGFB1 500 µg 1613 € novo human
CA72 Recombinant Human Transforming Growth Factor β-1, TGFB1 (N-8His) 500 µg 1328 € novo human
CJ79 Recombinant Human Transforming Growth Factor β-2, TGFB2 500 µg 1613 € novo human
GWB-454E3D Recombinant Human Transforming Growth Factor-Beta 3 CHO bulk Ask price € genways bulk human
CJ44 Recombinant Human Transforming Growth Factor β-3, TGFB3 1 mg 2486 € novo human
GWB-498673 Recombinant Human Transforming Growth Factor Beta Induced 182 a.a. bulk Ask price € genways bulk human
GWB-FE5DB3 Recombinant Human Transforming Growth Factor Beta Receptor II bulk Ask price € genways bulk human
CC10 Recombinant Human Transforming Growth Factor Receptor Type II, TGFBR2 (C-Fc) 1 mg 2283 € novo human