Recombinant Human Microtubule-Associated Protein Tau, MAPT-D, Tau-D (C-6His)

Contact us
Catalog number: C177
Price: 6662 €
Supplier: abbex
Product name: Recombinant Human Microtubule-Associated Protein Tau, MAPT-D, Tau-D (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Microtubule-Associated Protein Tau-D is produced by our E, coli expression system and the target gene encoding Gln249-Gln381 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 37 kD
UniProt number: P10636
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MAPT-D, Tau-D (C-6His), Microtubule-Associated Protein Tau
Short name: MAPT-D, Tau-D (C-6His), Recombinant Microtubule-Associated Protein Tau
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MAPT-D, Taurine-D (C-6His), sapiens Microtubule-Associated Protein Taurine, recombinant H
Alternative technique: rec

Related Products :

C177 Recombinant Human Microtubule-Associated Protein Tau, MAPT-D, Tau-D (C-6His) 10 µg 156 € novo human
CH19 Recombinant Human Microtubule-Associated Protein Tau F, MAPT-F, TAU-F 10 µg 156 € novo human
DL-MAPt-Hu Human Microtubule Associated Protein Tau MAPt ELISA Kit 96T 869 € DL elisas human
AE34251GO-48 ELISA test for Goat Microtubule-associated protein tau (MAPT) 1x plate of 48 wells 402 € abebio human
AE34249MK-48 ELISA test for Monkey Microtubule-associated protein tau (MAPT) 1x plate of 48 wells 402 € abebio monkey
GENTAUR-58b8708913a3f Goat Microtubule-associated protein tau (MAPT) 100ug 2133 € MBS Recombinant Proteins human
GENTAUR-58b8708984d39 Goat Microtubule-associated protein tau (MAPT) 1000ug 2133 € MBS Recombinant Proteins human
GENTAUR-58b87089d9b04 Goat Microtubule-associated protein tau (MAPT) 100ug 2647 € MBS Recombinant Proteins human
GENTAUR-58b8708a4fe3b Goat Microtubule-associated protein tau (MAPT) 1000ug 2647 € MBS Recombinant Proteins human
AE34251GO Goat Microtubule-associated protein tau (MAPT) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE34251GO-96 Goat Microtubule-associated protein tau (MAPT) ELISA Kit 1x plate of 96 wells 671 € abebio human
EKU05955 Microtubule Associated Protein Tau (MAPt) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU05956 Microtubule Associated Protein Tau (MAPt) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU05957 Microtubule Associated Protein Tau (MAPt) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
AE34249MK Monkey Microtubule-associated protein tau (MAPT) ELISA Kit 48 wells plate 500 € ab-elisa elisas monkey
AE34249MK-96 Monkey Microtubule-associated protein tau (MAPT) ELISA Kit 1x plate of 96 wells 671 € abebio monkey
DL-MAPt-Mu Mouse Microtubule Associated Protein Tau MAPt ELISA Kit 96T 904 € DL elisas mouse
DL-MAPt-Ra Rat Microtubule Associated Protein Tau MAPt ELISA Kit 96T 962 € DL elisas rat
MBS620920 TPX2 (Targeting Protein for XKLP2, TPX2 Microtubule-associated Homolog, TPX2 Microtubule-associated Protein Homolog, C20orf2, Chromosome 20 Open Reading Frame 1, C20ORF1, Differentially Expressed in Cancerous and Noncancerous Lung Cells 2, Differentially 100ul 608 € MBS Polyclonals_1 human
abx254256 Anti-Mouse Microtubule Associated Protein Tau/Tau Protein ELISA Kit 96 tests 557 € abbex mouse
abx255522 Anti-Pig Microtubule Associated Protein Tau/Tau Protein ELISA Kit inquire 50 € abbex pig
MBS624662 Tau, phosphorylated (Ser422) (Tau Protein, Microtubule-associated Protein, MAP) Antibody 100ug 531 € MBS Polyclonals_1 human
MBS624352 Tau, phosphorylated (Thr217) (Tau Protein, Microtubule-associated Protein, MAP) Antibody 10 Blots 663 € MBS Polyclonals_1 human
MBS618870 Tau [pT231] (Tau Protein, Microtubule-associated Protein, MAP) Antibody 10 Blots 663 € MBS Polyclonals_1 human
MBS621052 Tau [pT231] (Tau Protein, Microtubule-associated Protein, MAP) (BSA, Glycerol & Azide Free) Antibody 100ul 730 € MBS Polyclonals_1 human
CE88 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α, MAP1LC3A (C-6His) 500 µg 1613 € novo human
abx262455 Anti-Microtubule-Associated Protein Tau 381 a.a. Protein (Recombinant) 1 mg 6662 € abbex human
abx262449 Anti-Microtubule-Associated Protein Tau 383 a.a. Protein (Recombinant) 1 mg 6662 € abbex human
abx263440 Anti-Microtubule-Associated Protein Tau 412 a.a. Protein (Recombinant) 5 µg 340 € abbex human
abx262840 Anti-Microtubule-Associated Protein Tau Protein (Recombinant) 1 mg 6662 € abbex human