| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Heme Oxygenase 1 is produced by our E, coli expression system and the target gene encoding Met1-Thr261 is expressed |
| Molecular Weight: |
29, 86 kD |
| UniProt number: |
P09601 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
1 mM EDTA, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNT |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HO-1, Heme Oxygenase 1 |
| Short name: |
HO-1, Recombinant Heme Oxygenase 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
HO-1, sapiens Heme Oxygenase 1, recombinant H |
| Alternative technique: |
rec |
| Identity: |
5013 |
| Gene: |
HMOX1 |
More about : HMOX1 |
| Long gene name: |
heme oxygenase 1 |
| Synonyms gene name: |
heme oxygenase (decycling) 1 |
| Synonyms: |
bK286B10 HO-1 |
| Locus: |
22q12, 3 |
| Discovery year: |
1992-10-15 |
| Entrez gene record: |
3162 |
| Pubmed identfication: |
10591208 |
| Havana BLAST/BLAT: |
OTTHUMG00000150960 |