Recombinant Human β-Arrestin 1, ARRB1 (C-6His)

Contact us
Catalog number: C102
Price: 2172 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human β-Arrestin 1, ARRB1 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human beta-Arrestin 1 is produced by our E, coli expression system and the target gene encoding Met1-Arg418 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13 kD, 48
UniProt number: P49407
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNRLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ARRB1 (C-6His), &beta, -Arrestin 1
Short name: ARRB1 (C-6His), -Arrestin 1, Recombinant &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: arrestin, b 1 (C-6His), sapiens &beta, -Arrestin 1, recombinant H
Alternative technique: rec
Alternative to gene target: ARB1 and ARR1, ARRB1 and IDBG-635576 and ENSBTAG00000020485 and 281637, ARRB1 and IDBG-64687 and ENSG00000137486 and 102724825, Arrb1 and IDBG-200741 and ENSMUSG00000018909 and 109689, beta 1, nuclei, this GO :0000139 and this GO lgi membrane and cellular component this GO :0000785 and chromatin and cellular component this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002031 and G-protein coupled receptor internalization and biological process this GO :0002092 and positive regulation of receptor internalization and biological process this GO :0004857 and enzyme inhibitor activity and molecular function this GO :0005096 and GTPase activator activity and molecular function this GO :0005159 and insulin-like growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005765 and lysosomal membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0005834 and heterotrimeric G-protein complex and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005905 and coated pit and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006892 and post- this GO lgi vesicle-mediated transport and biological process this GO :0007165 and signal transduction and biological process this GO :0007219 and Notch signaling pathway and biological process this GO :0007596 and blood coagulation and biological process this GO :0007602 and phototransduction and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008277 and regulation of G-protein coupled receptor protein signaling pathway and biological process this GO :0015031 and protein transport and biological process this GO :0016567 and protein ubiquitination and biological process this GO :0030168 and platelet activation and biological process this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0031143 and pseudopodium and cellular component this GO :0031397 and negative regulation of protein ubiquitination and biological process this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0031434 and mitogen-activated protein kinase kinase binding and molecular function this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0031701 and angiotensin receptor binding and molecular function this GO :0032088 and negative regulation of NF-kappaB transcription factor activity and biological process this GO :0032092 and positive regulation of protein binding and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032717 and negative regulation of interleukin-8 production and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0035025 and positive regulation of Rho protein signal transduction and biological process this GO :0035066 and positive regulation of histone acetylation and biological process this GO :0035774 and positive regulation of insulin secretion involved in cellular response to glucose stimulus and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043149 and stress fiber assembly and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043161 and proteasome-mediated ubiquitin-dependent protein catabolic process and biological process this GO :0043547 and positive regulation of GTPase activity and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0061024 and membrane organization and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0090240 and positive regulation of histone H4 acetylation and biological process, this GO :0004857 : enzyme inhibitor activity, this GO :0004857 : enzyme inhibitor activity and also this GO :0005096 : GTPase activator activity and also this GO :0005159 : insulin-like growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0031434 : mitogen-activated protein kinase kinase binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0031701 : angiotensin receptor binding and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process and also this GO :0044212 : transcription regulatory region DNA binding, this GO :0005096 : GTPase activator activity, this GO :0005159 : insulin-like growth factor receptor binding, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0031434 : mitogen-activated protein kinase kinase binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0031701 : angiotensin receptor binding, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0044212 : transcription regulatory region DNA binding, transcription regulatory region DNA binding, 408, 102724972, arrestin
Identity: 711
Gene: ARRB1 | More about : ARRB1
Long gene name: arrestin beta 1
Synonyms gene: ARR1
Synonyms gene name: arrestin, beta 1
Synonyms name: arrestin 2
Locus: 11q13, 4
Discovery year: 1994-01-10
GenBank acession: BC003636
Entrez gene record: 408
Pubmed identfication: 8486659
RefSeq identity: NM_004041
Classification: Classical arrestins
Havana BLAST/BLAT: OTTHUMG00000165444

Related Products :

C102 Recombinant Human β-Arrestin 1, ARRB1 (C-6His) 50 µg 369 € novo human
AP06496PU-N anti-Arrestin beta-1 / ARRB1 Antibody 0,1 mg 558 € acr human
AP06791PU-N anti-Arrestin beta-1 / ARRB1 Antibody 0,1 mg 558 € acr human
B0455-1 anti-Arrestin beta-1 / ARRB1 Antibody 50 Вµg 347 € acr human
B0455-2 anti-Arrestin beta-1 / ARRB1 Antibody 0,1 mg 500 € acr human
C12056-1 anti-Arrestin beta-1 / ARRB1 Antibody 50 Вµg 347 € acr human
C12056-2 anti-Arrestin beta-1 / ARRB1 Antibody 0,1 mg 500 € acr human
CPA3135-100ul anti-Arrestin beta-1 / ARRB1 Antibody 0,1 ml 442 € acr human
CPA3135-200ul anti-Arrestin beta-1 / ARRB1 Antibody 0,2 ml 688 € acr human
CPA3135-30ul anti-Arrestin beta-1 / ARRB1 Antibody 30 Вµl 326 € acr human
CPA4569-100ul anti-Arrestin beta-1 / ARRB1 Antibody 0,1 ml 442 € acr human
CPA4569-200ul anti-Arrestin beta-1 / ARRB1 Antibody 0,2 ml 688 € acr human
CPA4569-30ul anti-Arrestin beta-1 / ARRB1 Antibody 30 Вµl 326 € acr human
AP55695PU-N anti-Arrestin beta-1 / ARRB1 pSer412 Antibody 0,1 ml 543 € acr human
AP55695PU-S anti-Arrestin beta-1 / ARRB1 pSer412 Antibody 50 Вµl 442 € acr human
CPA1078-100ul anti-Arrestin beta-1 / ARRB1 pSer412 Antibody 0,1 ml 529 € acr human
CPA1078-200ul anti-Arrestin beta-1 / ARRB1 pSer412 Antibody 0,2 ml 819 € acr human
CPA1078-30ul anti-Arrestin beta-1 / ARRB1 pSer412 Antibody 30 Вµl 355 € acr human
MBS612297 Arrestin 1, beta (ARRB1, ARB1, ARR1) 100ug 774 € MBS Polyclonals_1 human
MBS610685 Arrestin 1, beta, phosphorylated (Ser412) (ARRB1, ARB1, ARR1) Antibody 100ul 663 € MBS Polyclonals_1 human
EKU02573 Arrestin Beta 1 (ARRb1) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
AE55526RB-48 ELISA test for Rabbit Beta-arrestin-1 (ARRB1) 1x plate of 48 wells 402 € abebio human
GENTAUR-58bd73982b5ce Rabbit Beta-arrestin-1 (ARRB1) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bd73987d435 Rabbit Beta-arrestin-1 (ARRB1) 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bd7398c80ee Rabbit Beta-arrestin-1 (ARRB1) 100ug 2669 € MBS Recombinant Proteins human
GENTAUR-58bd739924c69 Rabbit Beta-arrestin-1 (ARRB1) 1000ug 2669 € MBS Recombinant Proteins human
AE55526RB Rabbit Beta-arrestin-1 (ARRB1) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE55526RB-96 Rabbit Beta-arrestin-1 (ARRB1) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58b37e0d82201 Rat Beta-arrestin-1 (Arrb1) 100ug 2172 € MBS Recombinant Proteins rat
GENTAUR-58b37e0dbbd8e Rat Beta-arrestin-1 (Arrb1) 1000ug 2172 € MBS Recombinant Proteins rat