Recombinant Human Acyl-Protein Thioesterase 1, APT-1 (N-6His)

Contact us
Catalog number: C097
Price: 2227 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Acyl-Protein Thioesterase 1, APT-1 (N-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Acyl-Protein Thioesterase 1 is produced by our E, coli expression system and the target gene encoding Met1-Asp230 is expressed with a 6His tag at the N-terminus
Molecular Weight: 26, 83 kD
UniProt number: O75608
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 10% Glycerol, 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: APT-1 (N-6His), Acyl-Protein Thioesterase 1
Short name: APT-1 (N-6His), Recombinant Acyl-Protein Thioesterase 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: APT-1 (N-6His), sapiens Acyl-Protein Thioesterase 1, recombinant H
Alternative technique: rec

Related Products :

C097 Recombinant Human Acyl-Protein Thioesterase 1, APT-1 (N-6His) 10 µg 156 € novo human
CF43 Recombinant Human Acyl-Protein Thioesterase 2, LYPLA2, APT2 (C-6His) 50 µg 339 € novo human
C891 Recombinant Human Acyl-Coenzyme A Thioesterase 13, ACOT13 (C-6His) 500 µg 1613 € novo human
CC64 Recombinant Human Palmitoyl-Protein Thioesterase 1, PPT1 (C-6His) 10 µg 146 € novo human
GENTAUR-58bb46edbed77 Human Acyl-protein thioesterase 1 (LYPLA1) 100ug 1691 € MBS Recombinant Proteins human
GENTAUR-58bb46ee17584 Human Acyl-protein thioesterase 1 (LYPLA1) 1000ug 1691 € MBS Recombinant Proteins human
GENTAUR-58bb46ee64307 Human Acyl-protein thioesterase 1 (LYPLA1) 100ug 2205 € MBS Recombinant Proteins human
GENTAUR-58bb46ee9d309 Human Acyl-protein thioesterase 1 (LYPLA1) 1000ug 2205 € MBS Recombinant Proteins human
GENTAUR-58bd57aa0ee35 human Acyl-protein thioesterase 2 1 mg 1475 € MBS Recombinant Proteins human
GENTAUR-58bd57aa62142 human Acyl-protein thioesterase 2 0.05 mg 265 € MBS Recombinant Proteins human
GENTAUR-58bd57aaac454 human Acyl-protein thioesterase 2 0.5 mg 951 € MBS Recombinant Proteins human
GENTAUR-58bd57aae4812 human Acyl-protein thioesterase 2 0.2 mg 564 € MBS Recombinant Proteins human
GENTAUR-58b9e0d64cdbf Human Acyl-protein thioesterase 2 (LYPLA2) 100ug 1691 € MBS Recombinant Proteins human
GENTAUR-58b9e0d6b8c3c Human Acyl-protein thioesterase 2 (LYPLA2) 1000ug 1691 € MBS Recombinant Proteins human
GENTAUR-58b9e0d71e914 Human Acyl-protein thioesterase 2 (LYPLA2) 100ug 2205 € MBS Recombinant Proteins human
GENTAUR-58b9e0d79ad8a Human Acyl-protein thioesterase 2 (LYPLA2) 1000ug 2205 € MBS Recombinant Proteins human
GENTAUR-58ba778f7f663 Human Acyl-coenzyme A thioesterase 8 (ACOT8) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58ba77900ccca Human Acyl-coenzyme A thioesterase 8 (ACOT8) 1000ug 1923 € MBS Recombinant Proteins human
GENTAUR-58ba77907db15 Human Acyl-coenzyme A thioesterase 8 (ACOT8) 100ug 2431 € MBS Recombinant Proteins human
GENTAUR-58ba7790f3854 Human Acyl-coenzyme A thioesterase 8 (ACOT8) 1000ug 2431 € MBS Recombinant Proteins human
GENTAUR-58bdc0212c1e0 Mouse Anti-Human Acyl-Coenzyme A Thioesterase 11 Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc02199151 Mouse Anti-Human Acyl-Coenzyme A Thioesterase 11 Antibody 0.02 miligrams 277 € MBS mono human
GENTAUR-58bdc02203fd7 Mouse Anti-Human Acyl-Coenzyme A Thioesterase 11 Antibody 100ug 608 € MBS mono human
GENTAUR-58bd72beae366 Bovine Acyl-protein thioesterase 1 (LYPLA1) 100ug 1691 € MBS Recombinant Proteins bovine
GENTAUR-58bd72bf0d599 Bovine Acyl-protein thioesterase 1 (LYPLA1) 1000ug 1691 € MBS Recombinant Proteins bovine
GENTAUR-58bd72bf5559d Bovine Acyl-protein thioesterase 1 (LYPLA1) 100ug 2205 € MBS Recombinant Proteins bovine
GENTAUR-58bd72bfa15af Bovine Acyl-protein thioesterase 1 (LYPLA1) 1000ug 2205 € MBS Recombinant Proteins bovine
GENTAUR-58bc9e8595ccd Cryptococcus neoformans var. neoformans serotype D Acyl-protein thioesterase 1 (CNBF2260) 100ug 1713 € MBS Recombinant Proteins human
GENTAUR-58bc9e85e621f Cryptococcus neoformans var. neoformans serotype D Acyl-protein thioesterase 1 (CNBF2260) 1000ug 1713 € MBS Recombinant Proteins human
GENTAUR-58bc9e863c3a6 Cryptococcus neoformans var. neoformans serotype D Acyl-protein thioesterase 1 (CNBF2260) 100ug 2227 € MBS Recombinant Proteins human