Recombinant Human VEGF-A, VEGF165

Contact us
Catalog number: C083
Price: 579 €
Supplier: genways
Product name: Recombinant Human VEGF-A, VEGF165
Quantity: 1 vial
Other quantities: 1 mg 2587€ 500 µg 1826€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vascular Endothelial Growth Factor A is produced by our Mammalian expression system and the target gene encoding Ala27-Arg191 is expressed
Molecular Weight: 1 kD, 19
UniProt number: P15692-4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VEGF165, VEGF-A
Short name: VEGF165, Recombinant VEGF-A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VEGF165, sapiens VEGF-A, recombinant H
Alternative technique: rec
Identity: 12680
Gene: VEGFA | More about : VEGFA
Long gene name: vascular endothelial growth factor A
Synonyms gene: VEGF
Synonyms gene name: vascular endothelial growth factor
Synonyms: VEGF-A VPF
Locus: 6p21, 1
Discovery year: 1994-01-10
GenBank acession: AB021221
Entrez gene record: 7422
Pubmed identfication: 8786112
RefSeq identity: NM_001025366
Classification: VEGF family
Havana BLAST/BLAT: OTTHUMG00000014745
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

C083 Recombinant Human VEGF-A, VEGF165 10 µg 202 € novo human
VEGF35-R-10 Mouse Recombinant VEGF165 (VEGF-A) Protein (E.Coli), biologically active 10 μg 521 € adi mouse
VEGF35-R-100 Mouse Recombinant VEGF165 (VEGF-A) Protein (E.Coli), biologically active 100 μg 2660 € adi mouse
VEGF26-R-10 Human Recombinant VEGF165 Protein (E.Coli), biologically active 10 μg 521 € adi human
VEGF26-R-100 Human Recombinant VEGF165 Protein (E.Coli), biologically active 100 μg 2660 € adi human
VEGF26-R-1000 Human Recombinant VEGF165 Protein (E.Coli), biologically active 1000 μg 10925 € adi human
VEGF27-R-100 Human Recombinant VEGF165 Protein (HEK), biologically active 100 μg 2878 € adi human
VEGF27-R-10 Human Recombinant VEGF165 Protein (Sf9), biologically active 10 μg 521 € adi human
VEGF27-R-1000 Human Recombinant VEGF165 Protein (Sf9), biologically active 1000 μg 10925 € adi human
GWB-BIG144 Recombinant Human VEGF165 bulk Ask price € genways bulk human
RP-1805H Recombinant Human VEGF165 Protein 50ug 688 € adv human
GWB-B830C0 VEGF165, Active Human Recombinant Protein bulk Ask price € genways bulk human
CJ93 Recombinant Human VEGF Receptor 1, VEGF R1, FLT-1 (C-Fc) 500 µg 1115 € novo human
CJ92 Recombinant Human VEGF Receptor 2, VEGF R2, FLK-1, KDR (C-Fc) 500 µg 1115 € novo human
GWB-P0589D VEGF165, 207-370aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-P0790J VEGF165, 207-371aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-76A963 VEGF165, Active Murine Recombinant Protein bulk Ask price € genways bulk human
ZR-40-162 VEGF165 Recombinant Protein 0.002 mg 256 € Zyagen human
ZR-40-482 VEGF165 Recombinant Protein 0.002 mg 256 € Zyagen human
abx153466 Anti-Human VEGF165 ELISA Kit inquire 50 € abbex human
abx574508 Anti-Human VEGF165 ELISA Kit inquire 50 € abbex human
DL-VEGF165-Hu Human Vascular Endothelial Growth Factor 165 VEGF165 ELISA Kit 96T 788 € DL elisas human
OBT1752 Vascular Endothelial Growth Factor (VEGF165 & VEGF121), Clone: 26503, Mouse Monoclonal antibody-Human; IH/ELISA/WB/Neutralizes 0.5mg Ask price € accurate-monoclonals human
DEVAS1721 Vascular Endothelial Growth Factor (VEGF), Clone: mxsghk-VEGF, Mouse Monoclonal antibody-Human; ELISA 200ug 448 € accurate-monoclonals human
abx575598 Anti-Cow VEGF165 ELISA Kit 96 tests 789 € abbex cow
GENTAUR-58be3bad8f75a Anti- VEGF165 Antibody 100ug 370 € MBS Polyclonals human
DL-VEGF165-b Bovine Vascular Endothelial Growth Factor 165 VEGF165 ELISA Kit 96T 904 € DL elisas bovine
GWB-4077C0 Vascular Endothelial Growth Factor 165 (VEGF165) 1 x 1 vial 579 € genways human
EKU08086 Vascular Endothelial Growth Factor 165 (VEGF165) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
GWB-ED9550 Vascular Endothelial Growth Factor 165 (VEGF165) Mouse 1 vial 579 € genways mouse