Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2

Contact us
Catalog number: C056
Price: 619 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 6 kD, 7
UniProt number: P02775
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CXCL7, NAP-2, C-X-C Motif Chemokine 7
Short name: CXCL7, NAP-2, Recombinant C-X-C Motif Chemokine 7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CXCL7, NAP-2, sapiens C-X-C Motif Chemokine 7, recombinant H
Alternative technique: rec
Identity: 9240
Gene: PPBP | More about : PPBP
Long gene name: pro-platelet basic protein
Synonyms gene: THBGB1
Synonyms: SCYB7 TGB NAP-2-L1 LA-PF4 MDGF LDGF Beta-TG CTAP3 CXCL7 PBP b-TG1 TGB1 CTAPIII NAP-2
Synonyms name: platelet basic protein beta-thromboglobulin connective tissue-activating peptide III neutrophil-activating peptide-2 chemokine (C-X-C motif) ligand 7
Locus: 4q13, 3
Discovery year: 1991-05-21
GenBank acession: M54995
Entrez gene record: 5473
Pubmed identfication: 1826003
RefSeq identity: NM_002704
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000130008

Related Products :

C056 Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2 500 µg 1613 € novo human
CI83 Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2 (C-6His) 10 µg 100 € novo human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
GWB-BIG0E3 Recombinant Human NAP-2 (CXCL7) bulk Ask price € genways bulk human
RP-2216R Recombinant Rat NAP-2 / PPBP / CXCL7 Protein (His Tag) 20μg 572 € adv rat
RP-1192RC Recombinant Rhesus NAP-2 / PPBP / CXCL7 Protein (His Tag) 20μg 572 € adv rhesus
101-M81 Anti-Human NAP-2 (CXCL7) 500ug 310 € Reliatech antibodies human
R31872 NAP-2 Antibody / CXCL7 0.1mg 406 € NJS poly human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58b817cf5fae0 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b817d11a352 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b817d157458 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 2382 € MBS Recombinant Proteins human
GENTAUR-58b817d1bbb6d Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 2382 € MBS Recombinant Proteins human
GENTAUR-58b84140aa491 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b841410949e Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b84141493c8 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 2382 € MBS Recombinant Proteins human
GENTAUR-58b8414194b27 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 2382 € MBS Recombinant Proteins human
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human
MBS611205 LEC, NCC-4 (Liver-Expressed Chemokine, New Chemokine CC-4, Small Inducible Cytokine Subfamily A (Cys X Cys) member 16, SCYA16, IL-10-inducible Chemokine, Monotactin-1) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS623554 CCR7 (C-C Chemokine Receptor Type 7, Chemokine (C-C Motif) Receptor 7, C-C CKR-7, CC-CKR-7, CCR-7, BLR2, CD197, CDw197, CMKBR7, Epstein-Barr Virus-induced G-protein Coupled Receptor 1, EBV Induced G Protein Coupled Receptor 1, EBI1, EVI1, MIP-3 beta Recep Antibody 100ug 619 € MBS Polyclonals_1 virus