Recombinant Human TNF-Like 1, TL1A, TNFSF15

Contact us
Catalog number: C038
Price: 500 €
Supplier: acr
Product name: Recombinant Human TNF-Like 1, TL1A, TNFSF15
Quantity: 0,1 mg
Other quantities: 1 mg 2729€ 10 µg 168€ 500 µg 1927€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human TNF-like 1 is produced by our E, coli expression system and the target gene encoding Met1-Leu192 is expressed
Molecular Weight: 21, 86 kD
UniProt number: O95150-2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 250 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene: TNFSF15 | More about : TNFSF15
Gene target: TL1A, TNFSF15, TNF-Like 1
Short name: TL1A, TNFSF15, Recombinant TNF-Like 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TL1A, member 15, sapiens tumor necrosis factor-Like 1, tumor necrosis factor (ligand) superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: DIF and TNF-alpha and TNFA and TNFSF2, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045994 and positive regulation of translational initiation by iron and biological process this GO :0046325 and negative regulation of glucose import and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050708 and regulation of protein secretion and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050796 and regulation of insulin secretion and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050901 and leukocyte tethering or rolling and biological process this GO :0050966 and detection of mechanical stimulus involved in sensory perception of pain and biological process this GO :0050995 and negative regulation of lipid catabolic process and biological process this GO :0051023 and regulation of immunoglobulin secretion and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051222 and positive regulation of protein transport and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051533 and positive regulation of NFAT protein import into nucleus and biological process this GO :0051798 and positive regulation of hair follicle development and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055037 and recycling endosome and cellular component this GO :0060557 and positive regulation of vitamin D biosynthetic process and biological process this GO :0060559 and positive regulation of calcidiol 1-monooxygenase activity and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060693 and regulation of branching involved in salivary gland morphogenesis and biological process this GO :0061048 and negative regulation of branching involved in lung morphogenesis and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071230 and cellular response to amino acid stimulus and biological process this GO :0071316 and cellular response to nicotine and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071677 and positive regulation of mononuclear cell migration and biological process this GO :0071803 and positive regulation of podosome assembly and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097527 and necroptotic signaling pathway and biological process this GO :1990268 and response to this GO ld nanoparticle and biological process this GO :2000010 and positive regulation of protein localization to cell surface and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process this GO :2000377 and regulation of reactive oxygen species metabolic process and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, Extracellular, Extracellular, TL1 and TL1A and VEGI and VEGI192A, TNF and IDBG-300259 and ENSG00000232810 and 7124, TNF and IDBG-634161 and ENSBTAG00000025471 and 280943, TNFSF15 and IDBG-638648 and ENSBTAG00000018069 and 514239, TNFSF15 and IDBG-82298 and ENSG00000181634 and 9966, Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926, Tnfsf15 and IDBG-155748 and ENSMUSG00000050395 and 326623, member 15, protein binding, this GO :0000060 and protein import into nucleus, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0044212 : transcription regulatory region DNA binding, this GO :0005102 and receptor binding and molecular function this GO :0005123 and death receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007250 and activation of NF-kappaB-inducing kinase activity and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042107 and cytokine metabolic process and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005123 : death receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding, this GO :0005123 : death receptor binding, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0044212 : transcription regulatory region DNA binding, transcription regulatory region DNA binding, translocation and biological process this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000165 and MAPK cascade and biological process this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001775 and cell activation and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001891 and pha this GO cytic cup and cellular component this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002020 and protease binding and molecular function this GO :0002037 and negative regulation of L-glutamate transport and biological process this GO :0002439 and chronic inflammatory response to antigenic stimulus and biological process this GO :0002740 and negative regulation of cytokine secretion involved in immune response and biological process this GO :0002876 and positive regulation of chronic inflammatory response to antigenic stimulus and biological process this GO :0002925 and positive regulation of humoral immune response mediated by circulating immunoglobulin and biological process this GO :0003009 and skeletal muscle contraction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006927 and transformed cell apoptotic process and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007254 and JNK cascade and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009651 and response to salt stress and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010693 and negative regulation of alkaline phosphatase activity and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014823 and response to activity and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019722 and calcium-mediated signaling and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030730 and sequestering of triglyceride and biological process this GO :0031334 and positive regulation of protein complex assembly and biological process this GO :0031622 and positive regulation of fever generation and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032722 and positive regulation of chemokine production and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032741 and positive regulation of interleukin-18 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032800 and receptor biosynthetic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0034116 and positive regulation of heterotypic cell-cell adhesion and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042346 and positive regulation of NF-kappaB import into nucleus and biological process this GO :0042493 and response to drug and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043068 and positive regulation of programmed cell death and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043242 and negative regulation of protein complex disassembly and biological process this GO :0043243 and positive regulation of protein complex disassembly and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043507 and positive regulation of JUN kinase activity and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0044130 and negative regulation of growth of symbiont in host and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045080 and positive regulation of chemokine biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045123 and cellular extravasation and biological process this GO :0045416 and positive regulation of interleukin-8 biosynthetic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045760 and positive regulation of action potential and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045892 and negative regulation of transcription, tumor necrosis factor, tumor necrosis factor (ligand) superfamily
Identity: 11931
Long gene name: tumor necrosis factor superfamily member 15
Synonyms gene name: member 15 , tumor necrosis factor (ligand) superfamily
Synonyms: TL1 VEGI TL1A VEGI192A MGC129934 MGC129935
Synonyms name: vascular endothelial cell growth inhibitor TNF superfamily ligand TL1A TNF ligand-related molecule 1 vascular endothelial growth inhibitor-192A
Locus: 9q32
Discovery year: 1998-12-04
GenBank acession: AF039390
Entrez gene record: 9966
Pubmed identfication: 9434163
RefSeq identity: NM_005118
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000021011

Related Products :

C038 Recombinant Human TNF-Like 1, TL1A, TNFSF15 10 µg 168 € novo human
CM93 Recombinant Mouse TNF-Like 1, TL1A, TNFSF15 1 mg 2486 € novo mouse
GWB-D3C992 TNF Ligand Superfamily, Member 15 (TL1A/TNFSF15) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-6352D0 TNF Ligand Superfamily, Member 15 (TL1A/TNFSF15) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 tube 602 € genways human
RP-1513H Recombinant Human TL1A / TNFSF15 Protein (Fc Tag) 20μg 456 € adv human
MBS242030 Anti-Human TNFSF15 / TL1A / VEGI 50ug 597 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
TNFR25-R-20 Recombinant purified human TNF Receptor 2 (TNFR2/TNF-RII, Etannercept/TNF-R75, p75TNFR) protein (E.Coli, His-tag) 10 μg 333 € adi human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
MBS223395 Anti-TL1A (N-TERMINAL) Antibody 100ug 437 € MBS Polyclonals_1 human
MBS223969 Anti-TL1A (N-TERMINAL) Antibody 50ug 299 € MBS Polyclonals_1 human
MBS150074 TL1A Antibody 100ug 431 € MBS Polyclonals_1 human
MBS150585 TL1A Antibody 100ug 431 € MBS Polyclonals_1 human
MBS535934 TL1A antibody 50ug 470 € MBS Polyclonals_1 human
MBS273098 TL1A antibody [C2C3], C-term 100ul 426 € MBS Polyclonals_1 human
GWB-5851DE TL1A antibody (N-terminus) 1 x 1 vial 337 € genways human
GWB-8A606C TL1A antibody (N-terminus) 1 vial 516 € genways human
ZP-3109 TL1A Peptide 0.05 mg 204 € Zyagen human
APO-3109 TL1A Rabbit Polyclonal Antibody 0.1 mg 428 € Zyagen human
APO-3789 TL1A Rabbit Polyclonal Antibody 0.1 mg 428 € Zyagen human
6424 Recombinant Chicken TNFSF15 5 µg 220 € Immunochemistry kits chicken
GWB-P0989A TNFSF15, 72-251aa, Recombinant Protein bulk Ask price € genways bulk human
MBS621181 ADAM17 (CD156b, Disintegrin and Metalloproteinase Domain-containing Protein 17, TNF-alpha-converting Enzyme, TNF-alpha Convertase, Snake Venom-like Protease, CSVP, TACE) Antibody 50ug 873 € MBS Polyclonals_1 human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
AR09989PU-L anti-TNFSF15 (72-251, His-tag) Antibody 0,5 mg 1138 € acr human
AR09989PU-N anti-TNFSF15 (72-251, His-tag) Antibody 0,1 mg 485 € acr human
A01T0159 anti-TNFSF15 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AP06649PU-N anti-TNFSF15 Antibody 0,1 mg 558 € acr human
C10215-1 anti-TNFSF15 Antibody 50 Вµg 347 € acr human
C10215-2 anti-TNFSF15 Antibody 0,1 mg 500 € acr human