Recombinant Human Epidermal Growth Factor, EGF

Contact us
Catalog number: C029
Price: 398 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Epidermal Growth Factor, EGF
Quantity: 50ug
Other quantities: 10 µg 70€ 50 µg 100€ 500 µg 149€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Epidermal Growth Factor is produced by our E, coli expression system and the target gene encoding Asn971-Arg1023 is expressed
Molecular Weight: 2 kD, 6
UniProt number: P01133
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 200 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EGF, Epidermal Growth Factor
Short name: EGF, Recombinant Epidermal Growth Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: epidermal growth factor, sapiens Epidermal Growth Factor, recombinant H
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048754 and branching morphogenesis of an epithelial tube and biological process this GO :0050730 and regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051048 and negative regulation of secretion and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070371 and ERK1 and ERK2 cascade and biological process this GO :0090279 and regulation of calcium ion import and biological process this GO :0090370 and negative regulation of cholesterol efflux and biological process this GO :1900127 and positive regulation of hyaluronan biosynthetic process and biological process this GO :2000008 and regulation of protein localization to cell surface and biological process this GO :2000060 and positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process and biological process, EGF and IDBG-34100 and ENSG00000138798 and 1950, Egf and IDBG-193432 and ENSMUSG00000028017 and 13645, Extracellular, HOMG4 and URG, this GO :0000186 and activation of MAPKK activity and biological process this GO :0001525 and angiogenesis and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005154 and epidermal growth factor receptor binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005765 and lysosomal membrane and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006260 and DNA replication and biological process this GO :0007165 and signal transduction and biological process this GO :0007171 and activation of transmembrane receptor protein tyrosine kinase activity and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007262 and STAT protein import into nucleus and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0010800 and positive regulation of peptidyl-threonine phosphorylation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0021940 and positive regulation of cerebellar granule cell precursor proliferation and biological process this GO :0030168 and platelet activation and biological process this GO :0030297 and transmembrane receptor protein tyrosine kinase activator activity and molecular function this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0035413 and positive regulation of catenin import into nucleus and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042059 and negative regulation of epidermal growth factor receptor signaling pathway and biological process this GO :0042327 and positive regulation of phosphorylation and biological process this GO :0043388 and positive regulation of DNA binding and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045741 and positive regulation of epidermal growth factor-activated receptor activity and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045893 and positive regulation of transcription, this GO :0005154 : epidermal growth factor receptor binding, this GO :0005154 : epidermal growth factor receptor binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity, transmembrane receptor protein tyrosine kinase activator activity, epidermal growth factor
Identity: 3229
Gene: EGF | More about : EGF
Long gene name: epidermal growth factor
Synonyms gene name: epidermal growth factor (beta-urogastrone)
Locus: 4q25
Discovery year: 2001-06-22
GenBank acession: X04571
Entrez gene record: 1950
Havana BLAST/BLAT: OTTHUMG00000132044

Related Products :

MBS621693 CD312 (EMR2, Epidermal Growth Factor-Like Module-Containing Mucin-Like Receptor 2, Epidermal Growth Factor Seven Transmembrane, EGF-TM7) (Biotin) Antibody 50ug 818 € MBS Polyclonals_1 human
BYA9681-1 Epidermal Growth Factor (EGF), 6kD, Clone: EGF-10, Mouse Monoclonal antibody-Human (NO x w/Ms); paraffin 0.2 ml 1139 € accurate-monoclonals human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS624351 CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) Antibody 200ul 597 € MBS Polyclonals_1 human
GWB-1B6E07 Epidermal Growth Factor (EGF) (recombinant) Human AG 1 x 1 vial 579 € genways human
GWB-EE3CF7 Epidermal Growth Factor (EGF) (recombinant) Human AG 1 vial 845 € genways human
C029 Recombinant Human Epidermal Growth Factor, EGF 1 mg 192 € novo human
CH28 Recombinant Mouse Epidermal Growth Factor, EGF (C-6His) 1 mg 1014 € novo mouse
abx575389 Anti-Human Epidermal Growth Factor (EGF) ELISA Kit inquire 50 € abbex human
YM8002-1 Epidermal Growth Factor (EGF), Clone: F5, Mouse Monoclonal antibody-Mouse, Human Brunner's Glands, frozen/paraffin 1000ul 443 € accurate-monoclonals human
YM8002-5 Epidermal Growth Factor (EGF), Clone: F5, Mouse Monoclonal antibody-Mouse, Human Brunner's Glands, frozen/paraffin 5 ml 1792 € accurate-monoclonals human
YIAK3007.1 Epidermal Growth Factor-Receptor (extracellular ligand binding site), Clone: EGF-R1, Mouse Monoclonal antibody-Human; paraffin, ELISA/IHC/FLOW 10 ug 227 € accurate-monoclonals human
YIAK3007.2 Epidermal Growth Factor-Receptor (extracellular ligand binding site), Clone: EGF-R1, Mouse Monoclonal antibody-Human; paraffin, ELISA/IHC/FLOW 0.1mg 1126 € accurate-monoclonals human
YIAK3008.1 Epidermal Growth Factor-Receptor (extracellular non ligand binding site), Clone: EGF-R2, Mouse Monoclonal antibody-Human; frozen/paraffin, ELISA/IHC/FLOW 10 ug 188 € accurate-monoclonals human
DL-EGF-Hu Human Epidermal Growth Factor EGF ELISA Kit 96T 568 € DL elisas human
GENTAUR-58bdc1e0f1789 Anti- Epidermal Growth Factor (EGF) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdc3b3457d8 Anti- Epidermal Growth Factor (EGF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc3b3a2ee9 Anti- Epidermal Growth Factor (EGF) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc52e1065d Anti- Epidermal Growth Factor (EGF) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc52e684b2 Anti- Epidermal Growth Factor (EGF) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc73eb58b9 Anti- Epidermal Growth Factor (EGF) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc73f1923d Anti- Epidermal Growth Factor (EGF) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc7f3158e9 Anti- Epidermal Growth Factor (EGF) Antibody 100ug 586 € MBS Polyclonals human
GENTAUR-58bdc9160c1ee Anti- Epidermal Growth Factor (EGF) Antibody 50ug 288 € MBS Polyclonals human
GENTAUR-58bdc91668cad Anti- Epidermal Growth Factor (EGF) Antibody 100ug 343 € MBS Polyclonals human
GENTAUR-58bdca6637c1c Anti- Epidermal Growth Factor (EGF) Antibody 100ug 343 € MBS Polyclonals human
GENTAUR-58bdca6694a15 Anti- Epidermal Growth Factor (EGF) Antibody 50ug 288 € MBS Polyclonals human
GENTAUR-58bdcce45dbae Anti- Epidermal Growth Factor (EGF) Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58bdcf6e3bb7c Anti- Epidermal Growth Factor (EGF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcf6eab562 Anti- Epidermal Growth Factor (EGF) Antibody 50ug 398 € MBS Polyclonals human