Recombinant Human Parathyroid Hormone, Parathormone, PTH (1-84)

Contact us
Catalog number: C010
Price: 597 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Parathyroid Hormone, Parathormone, PTH (1-84)
Quantity: 50ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1298€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: FSH comprise the , Human recombinant LHRG and GHRH are produced in E, The glands that secrete Luteinizing hormones LHRG and LH, The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine , coli or in yeast cells, Hormone releasing factors and releasing hormones are  , endocrine signaling system, glands , in , intracrine signaling) or nearby cells (paracrine signaling), multicellular organisms, or , produced by , signaling molecules 
Molecular Weight: 9 kD
UniProt number: P01270
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 5% Mannitol, pH 4, 2 um filtered solution of 10 mM HAc-NaAc, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PTH (1-84), Parathormone, Parathyroid Hormone
Short name: PTH (1-84), Parathormone, Recombinant Parathyroid Hormone
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Parathormone, parathyroid hormone (1-84), sapiens Parathyroid Hormone, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, PTH and IDBG-32891 and ENSG00000152266 and 5741, PTH and IDBG-632953 and ENSBTAG00000019080 and 280903, PTH1, Pth and IDBG-207092 and ENSMUSG00000059077 and 19226, peptide hormone receptor binding, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001501 and skeletal system development and biological process this GO :0003705 and RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007189 and adenylate cyclase-activating G-protein coupled receptor signaling pathway and biological process this GO :0007266 and Rho protein signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008628 and hormone-mediated apoptotic signaling pathway and biological process this GO :0009967 and positive regulation of signal transduction and biological process this GO :0010288 and response to lead ion and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030819 and positive regulation of cAMP biosynthetic process and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0031856 and parathyroid hormone receptor binding and molecular function this GO :0031857 and type 1 parathyroid hormone receptor binding and molecular function this GO :0033280 and response to vitamin D and biological process this GO :0034645 and cellular macromolecule biosynthetic process and biological process this GO :0042493 and response to drug and biological process this GO :0045453 and bone resorption and biological process this GO :0045471 and response to ethanol and biological process this GO :0045725 and positive regulation of glycogen biosynthetic process and biological process this GO :0045778 and positive regulation of ossification and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046058 and cAMP metabolic process and biological process this GO :0046326 and positive regulation of glucose import and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0051428 and peptide hormone receptor binding and molecular function this GO :0071107 and response to parathyroid hormone and biological process this GO :0071774 and response to fibroblast growth factor and biological process, this GO :0003705 : RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity, this GO :0003705 : RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity and also this GO :0005179 : hormone activity and also this GO :0031856 : parathyroid hormone receptor binding and also this GO :0031857 : type 1 parathyroid hormone receptor binding and also this GO :0051428 : peptide hormone receptor binding, this GO :0005179 : hormone activity, this GO :0031856 : parathyroid hormone receptor binding, this GO :0031857 : type 1 parathyroid hormone receptor binding, this GO :0051428 : peptide hormone receptor binding, parathyroid hormone
Identity: 9606
Gene: PTH | More about : PTH
Long gene name: parathyroid hormone
Synonyms: PTH1
Synonyms name: parathyrin parathormone parathyroid hormone 1 preproparathyroid hormone prepro-PTH
Locus: 11p15, 3
Discovery year: 2001-06-22
GenBank acession: J00301
Entrez gene record: 5741
Pubmed identfication: 1672845
RefSeq identity: NM_000315
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000165785

Related Products :

MBS614362 Parathyroid Hormone Receptor Type 2 (PTH Receptor 2, PTHR2, Parathyroid Hormone 2 Receptor, PTH2 Receptor, PTH-2 Receptor, PTH2R, Parathyroid Hormone Receptor Precursor) Antibody 100ul 652 € MBS Polyclonals_1 human
C010 Recombinant Human Parathyroid Hormone, Parathormone, PTH (1-84) 1 mg 1836 € novo human
GWB-DA2092 antibody to or anti- Parathyroid hormone/parathyroid hormone-related peptide sequence receptor antibody 1 vial 602 € genways human
GENTAUR-58b38045f1474 Didelphis marsupialis virginiana Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) 1000ug 2475 € MBS Recombinant Proteins human
GENTAUR-58b380462c6fd Didelphis marsupialis virginiana Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) 1000ug 2984 € MBS Recombinant Proteins human
GENTAUR-58b43815753a9 Didelphis marsupialis virginiana Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) 1000ug 2475 € MBS Recombinant Proteins human
GENTAUR-58b43815bb690 Didelphis marsupialis virginiana Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) 1000ug 2984 € MBS Recombinant Proteins human
RP-598 Recombinant (E. coli) Human Parathyroid Hormone PTH, (7-34) (>95%) 50 μg 260 € adi human
RP-591 Recombinant (E.Coli) Human Parathyroid Hormone (PTH, 1-34) 50 μg 478 € adi human
RP-597 Recombinant (E.Coli) Human Parathyroid Hormone (PTH, 1-84) 50 μg 478 € adi human
CB42 Recombinant Human Parathyroid Hormone, PTH (N-8His) 10 µg 126 € novo human
abx254234 Anti-Mouse intact Parathormone ELISA Kit 96 tests 557 € abbex mouse
abx254375 Anti-Mouse Parathormone ELISA Kit 96 tests 557 € abbex mouse
abx255779 Anti-Rat Intact Parathormone ELISA Kit inquire 50 € abbex rat
abx574184 Anti-Human Parathyroid Hormone (PTH) ELISA Kit 96 tests 731 € abbex human
GENTAUR-58be165d6ddb0 Anti-Human Parathyroid Hormone (PTH) MAb (Clone SP151) 1 mililiter 824 € MBS mono human
GENTAUR-58be16995ad64 Anti-Human Parathyroid Hormone (PTH) MAb (Clone SP151) 100ul 304 € MBS mono human
GENTAUR-58be16b79b364 Anti-Human Parathyroid Hormone (PTH) MAb (Clone SP151) 500ul 553 € MBS mono human
GENTAUR-58be16e055825 Anti-Human Parathyroid Hormone (PTH) MAb (Clone SP151) 7 ml (RTU) 492 € MBS mono human
MBS301916 Anti-Human Parathyroid Hormone (PTH) PAb 7 ml (RTU) 354 € MBS Polyclonals_1 human
MBS301917 Anti-Human Parathyroid Hormone (PTH) PAb 100ul 232 € MBS Polyclonals_1 human
MBS301918 Anti-Human Parathyroid Hormone (PTH) PAb 1 mililiter 542 € MBS Polyclonals_1 human
MBS302469 Anti-Human Parathyroid Hormone (PTH) PAb 500ul 387 € MBS Polyclonals_1 human
GWB-2F1E03 antibody to or anti- Parathyroid Hormone (PTH) Human antibody 1 x 1 vial 452 € genways human
GWB-A6DF8F antibody to or anti- Parathyroid Hormone (PTH) human antibody 1 vial 452 € genways human
GWB-7926F4 antibody to or anti- Parathyroid Hormone PTH (MidRegion) human antibody 1 tube 440 € genways human
GWB-AFA137 antibody to or anti- Parathyroid Hormone PTH (MidRegion) human antibody 1 vial 440 € genways human
GWB-771488 antibody to or anti- Parathyroid Hormone (PTH) N-terminusinal Human antibody 1 tube 440 € genways human
SP-101127-1 Biotin-Parathyroid Hormone (PTH, 1-34), human 1 mg 333 € adi human
MBS241899 Goat Polyclonal (IgG) to Human Parathyroid Hormone / PTH Antibody 50ug 597 € MBS Polyclonals_1 human