SAFB Antibody / Scaffold attachment factor B1

Contact us
Catalog number: R32563
Price: 1663 €
Supplier: MBS Recombinant Proteins
Product name: SAFB Antibody / Scaffold attachment factor B1
Quantity: 1000ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SAFB / Scaffold attachment factor B1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This SAFB antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q15424
Purity: Antigen affinity
Description: Complex subunit associated factors are involved in hybridoma growth, Eosinohils, NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation, Aplha
Immunogen: Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SAFB antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SAFB / Scaffold attachment factor B1
Short name: SAFB Antibody / Scaffold attachment factor B1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SAFB (Antibody to) / Scaffold attachment factor B1
Alternative technique: antibodies
Identity: 10520
Gene: SAFB | More about : SAFB
Long gene name: scaffold attachment factor B
Synonyms: HET SAFB1
Synonyms name: Hsp27 ERE-TATA binding protein
Locus: 19p13, 3
Discovery year: 1998-01-27
GenBank acession: L43631
Entrez gene record: 6294
Pubmed identfication: 9605873 8600450
Classification: RNA binding motif containing
Havana BLAST/BLAT: OTTHUMG00000180502

Related Products :

GWB-501577 Scaffold Attachment Factor B (SAFB) Mouse antibody to or anti-Human Monoclonal (aa345-357) (6F7) antibody 1 x 1 vial 602 € genways human
R32563 SAFB Antibody / Scaffold attachment factor B1 0.1mg 406 € NJS poly human
MBS623310 Scaffold Attachment Factor B1 (SAFB1, SAFB, DKFZP779C1727, Glutathione S Transferase Fusion Protein, HAP, HSP27 ERE-TATA-binding Protein, HSP27 Estrogen Response Element-TATA Box-binding Protein, HET, SAB-B1) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS275112 Scaffold attachment factor B1 antibody 100ul 426 € MBS Polyclonals_1 human
MBS270483 Scaffold attachment factor B2 antibody [N2C1], Internal 100ul 426 € MBS Polyclonals_1 human
MBS620611 Scaffold Attachment Factor B2 (SAFB2, SAF-B2, KIAA0138) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS610601 N-Ethylmaleimide Sensitive Factor Attachment Protein, gamma (NAPg, Soluble NSF Attachment Protein gamma, SNAPg) Antibody 50ug 625 € MBS Polyclonals_1 human
GENTAUR-58bde6d18d706 Mouse Monoclonal [clone 5A11] (IgG2b,k) to Human SAFB1 / SAFB Antibody 50ug 663 € MBS mono human
GENTAUR-58bde5a7bd704 Mouse Monoclonal [clone 6F7] (IgG1) to Human SAFB1 / SAFB Antibody 50ug 597 € MBS mono human
GENTAUR-58be4ca4e7fce SAFB-1 Antibody 100ug 393 € MBS mono human
CYT-006294-M04 SAFB monoclonal antibody (M04), clone 5A11 0.1mg 495 € Zyagen human
abx904768 Anti-SAFB siRNA 30 nmol 717 € abbex human
abx932400 Anti-SAFB siRNA inquire 50 € abbex human
abx932401 Anti-SAFB siRNA 30 nmol 717 € abbex human
GWB-128044 GRP1 (general Receptor For Phosphoinositides 1)-associated Scaffold protein (Grasp) Rabbit antibody to or anti-Mouse Polyclonal antibody 1 x 1 vial 602 € genways mouse
GWB-9932A7 P150 Target Of Rapamycin (TOR)-scaffold protein (Raptor) (KIAA1303) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-B8AC91 P150 Target Of Rapamycin (TOR)-scaffold protein (Raptor) (KIAA1303) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GENTAUR-58bdd42c6b88b Anti- Mitogen Activated Protein Kinase Scaffold Protein 1 (MAPKSP1) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd42cc870f Anti- Mitogen Activated Protein Kinase Scaffold Protein 1 (MAPKSP1) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd7ad53ebf Anti- Mitogen Activated Protein Kinase Scaffold Protein 1 (MAPKSP1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bddaf4cd4b6 Anti- Mitogen Activated Protein Kinase Scaffold Protein 1 (MAPKSP1) Antibody 100ug 509 € MBS Polyclonals human
MBS610488 Raptor, exon 26 (Regulatory Associated Protein of mTOR, p150 Target of Rapamycin (TOR) Scaffold Protein containing WD-repeats, KIAA1303) Antibody 50ug 658 € MBS Polyclonals_1 human
abx263274 Anti-Iron-sulfur Cluster Scaffold Homolog Protein (Recombinant) 50 µg 1674 € abbex human
abx260824 Anti-MAPK Scaffold Protein 1 Protein (Recombinant) 20 µg 340 € abbex human
GENTAUR-58b9ab0c2e982 Drosophila ananassae NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (GF20932) 100ug 1663 € MBS Recombinant Proteins drosophila
GENTAUR-58b9ab0c94c20 Drosophila ananassae NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (GF20932) 1000ug 1663 € MBS Recombinant Proteins drosophila
GENTAUR-58b9ab0d0f5d6 Drosophila ananassae NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (GF20932) 100ug 2177 € MBS Recombinant Proteins drosophila
GENTAUR-58b9ab0d5c6a6 Drosophila ananassae NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (GF20932) 1000ug 2177 € MBS Recombinant Proteins drosophila
GENTAUR-58ba273d26d69 Drosophila ananassae NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (GF20932) 100ug 1663 € MBS Recombinant Proteins drosophila
GENTAUR-58ba273db9659 Drosophila ananassae NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (GF20932) 1000ug 1663 € MBS Recombinant Proteins drosophila