| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SAFB / Scaffold attachment factor B1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This SAFB antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q15424 |
| Purity: |
Antigen affinity |
| Description: |
Complex subunit associated factors are involved in hybridoma growth, Eosinohils, NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation, Aplha |
| Immunogen: |
Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SAFB antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SAFB / Scaffold attachment factor B1 |
| Short name: |
SAFB Antibody / Scaffold attachment factor B1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SAFB (Antibody to) / Scaffold attachment factor B1 |
| Alternative technique: |
antibodies |
| Identity: |
10520 |
| Gene: |
SAFB |
More about : SAFB |
| Long gene name: |
scaffold attachment factor B |
| Synonyms: |
HET SAFB1 |
| Synonyms name: |
Hsp27 ERE-TATA binding protein |
| Locus: |
19p13, 3 |
| Discovery year: |
1998-01-27 |
| GenBank acession: |
L43631 |
| Entrez gene record: |
6294 |
| Pubmed identfication: |
9605873 8600450 |
| Classification: |
RNA binding motif containing |
| Havana BLAST/BLAT: |
OTTHUMG00000180502 |