Nectin-4 Antibody / PVRL4

Contact us
Catalog number: R32559
Price: 442 €
Supplier: acr
Product name: Nectin-4 Antibody / PVRL4
Quantity: 0,2 mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Nectin-4 / PVRL4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This Nectin-4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q96NY8
Purity: Antigen affinity
Description: Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined, It is a single-pass type I membrane protein, It is involved in cell adhesion through trans-homophilic and -heterophilic interactions, Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain, The secreted form is found in both breast tumor cell lines and breast tumor patients, The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE, This gene encodes a member of the nectin family, also known as Nectin-4, an autosomal recessive disorder, and cultured keratinocytes, but not in fibroblasts, hair follicles, is expressed in human skin, PVRL4
Immunogen: Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Nectin-4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Nectin-4 / PVRL4
Short name: Nectin-4 Antibody / PVRL4
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Nectin-4 (Antibody to) / poliovirus receptor-related 4
Alternative technique: antibodies
Alternative to gene target: Cell surfaces, PVRL4 and IDBG-104172 and ENSG00000143217 and 81607, PVRL4 and IDBG-630217 and ENSBTAG00000017877 and 507718, Pvrl4 and IDBG-204508 and ENSMUSG00000006411 and 71740, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005912 and adherens junction and cellular component this GO :0007155 and cell adhesion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034332 and adherens junction organization and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, poliovirus receptor-related 4
Identity: 19688
Gene: NECTIN4 | More about : NECTIN4
Long gene name: nectin cell adhesion molecule 4
Synonyms gene: PVRL4
Synonyms gene name: poliovirus receptor-related 4
Synonyms: nectin-4 PRR4 LNIR
Locus: 1q23, 3
Discovery year: 2004-02-11
GenBank acession: AF426163
Entrez gene record: 81607
Pubmed identfication: 11544254
RefSeq identity: NM_030916
Classification: C2-set domain containing V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000031475

Related Products :

C17761-1 anti-PVRL4 / Nectin 4 Antibody 50 Вµg 347 € acr human
C17761-2 anti-PVRL4 / Nectin 4 Antibody 0,1 mg 500 € acr human
R32559 Nectin-4 Antibody / PVRL4 0.1mg 406 € NJS poly human
CJ19 Recombinant Human Nectin-4, PVRL4 (C-6His) 50 µg 303 € novo human
GWB-F9709F NECTIN-2 (cross reactive with human nectin-2), antibody 1 vial 775 € genways human
A01P0317 anti-PVRL4 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bde8eb70966 Anti- PVRL4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde8ebc39eb Anti- PVRL4 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be14c5330ea Anti- PVRL4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be14c586bb9 Anti- PVRL4 Antibody 0.06 ml 265 € MBS Polyclonals human
abx217849 Anti-PVRL4 Antibody 200 μg 369 € abbex human
GWB-ASE843 Human PVRL4 Antibody bulk Ask price € genways bulk human
MBS275172 PVRL4 antibody [N1C1] 100ul 426 € MBS Polyclonals_1 human
abx152902 Anti-Human PVRL4 ELISA Kit 96 tests 934 € abbex human
abx574344 Anti-Human PVRL4 ELISA Kit inquire 50 € abbex human
abx930484 Anti-PVRL4 siRNA 30 nmol 717 € abbex human
abx930485 Anti-PVRL4 siRNA 15 nmol 528 € abbex human
GENTAUR-58bd97f0618a8 Bovine Poliovirus receptor-related protein 4 (PVRL4) 100ug 1917 € MBS Recombinant Proteins bovine
GENTAUR-58bd97f0b9ff6 Bovine Poliovirus receptor-related protein 4 (PVRL4) 1000ug 1917 € MBS Recombinant Proteins bovine
GENTAUR-58bd97f1169e9 Bovine Poliovirus receptor-related protein 4 (PVRL4) 100ug 2431 € MBS Recombinant Proteins bovine
GENTAUR-58bd97f174527 Bovine Poliovirus receptor-related protein 4 (PVRL4) 1000ug 2431 € MBS Recombinant Proteins bovine
AE24962HU-48 ELISA test for Human Poliovirus receptor-related protein 4 (PVRL4) 1x plate of 48 wells 373 € abebio human
AE24962HU-96 Human Poliovirus receptor-related protein 4 (PVRL4) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-PVRL4-Hu Human Poliovirus Receptor Related Protein 4 PVRL4 ELISA Kit 96T 904 € DL elisas human
EKU06731 Poliovirus Receptor Related Protein 4 (PVRL4) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
LV278965 PVRL4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-AB3A8F PVRL4 Over-expression Lysate reagent 1 vial 463 € genways human
AM26505AF-N anti-CD112 / Nectin 2 Antibody 0,1 mg 456 € acr human
AM26505FC-N anti-CD112 / Nectin 2 Antibody 0,1 ml 543 € acr human
AM31252AF-N anti-CD112 / Nectin 2 Antibody 0,2 mg 442 € acr human