| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Nectin-4 / PVRL4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This Nectin-4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q96NY8 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined, It is a single-pass type I membrane protein, It is involved in cell adhesion through trans-homophilic and -heterophilic interactions, Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain, The secreted form is found in both breast tumor cell lines and breast tumor patients, The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE, This gene encodes a member of the nectin family, also known as Nectin-4, an autosomal recessive disorder, and cultured keratinocytes, but not in fibroblasts, hair follicles, is expressed in human skin, PVRL4 |
| Immunogen: |
Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Nectin-4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Nectin-4 / PVRL4 |
| Short name: |
Nectin-4 Antibody / PVRL4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Nectin-4 (Antibody to) / poliovirus receptor-related 4 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
Cell surfaces, PVRL4 and IDBG-104172 and ENSG00000143217 and 81607, PVRL4 and IDBG-630217 and ENSBTAG00000017877 and 507718, Pvrl4 and IDBG-204508 and ENSMUSG00000006411 and 71740, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005912 and adherens junction and cellular component this GO :0007155 and cell adhesion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034332 and adherens junction organization and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, poliovirus receptor-related 4 |
| Identity: |
19688 |
| Gene: |
NECTIN4 |
More about : NECTIN4 |
| Long gene name: |
nectin cell adhesion molecule 4 |
| Synonyms gene: |
PVRL4 |
| Synonyms gene name: |
poliovirus receptor-related 4 |
| Synonyms: |
nectin-4 PRR4 LNIR |
| Locus: |
1q23, 3 |
| Discovery year: |
2004-02-11 |
| GenBank acession: |
AF426163 |
| Entrez gene record: |
81607 |
| Pubmed identfication: |
11544254 |
| RefSeq identity: |
NM_030916 |
| Classification: |
C2-set domain containing V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031475 |