PSMA2 Antibody / Proteasome 20S alpha 2

Contact us
Catalog number: R32556
Price: 426 €
Supplier: MBS Polyclonals_1
Product name: PSMA2 Antibody / Proteasome 20S alpha 2
Quantity: 100ul
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PSMA2 / Proteasome 20S alpha 2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This PSMA2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P25787
Purity: Antigen affinity
Description: 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits, An essential function of a modified proteasome, Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway, The core structure is composed of 4 rings of 28 non-identical subunits, The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure, This gene encodes a member of the peptidase T1A family, is the processing of class I MHC peptides, that is a 20S core alpha subunit, the immunoproteasome, Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene
Immunogen: Amino acids 82-123 (DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQ) from the human protein were used as the immunogen for the PSMA2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PSMA2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: nuclear, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PSMA2 / Proteasome 20S alpha 2
Short name: PSMA2 Antibody / Proteasome 20S alpha 2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: 2 (Antibody to) / protein degradation aggregate 20S a 2, a classification, macropain) subunit, proteasome (prosome
Alternative technique: antibodies
Alternative to gene target: 2, PSMA2 and IDBG-13609 and ENSG00000106588 and 5683, TAP-dependent and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0004298 and threonine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005839 and proteasome core complex and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0006521 and regulation of cellular amino acid metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006977 and DNA damage response, alpha type, alpha-subunit complex and cellular component this GO :0031145 and anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0034641 and cellular nitrogen compound metabolic process and biological process this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0051436 and negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051437 and positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051439 and regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, macropain) subunit, nuclei, protein binding, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0009615 and response to virus and biological process this GO :0010467 and gene expression and biological process this GO :0016032 and viral process and biological process this GO :0016070 and RNA metabolic process and biological process this GO :0016071 and mRNA metabolic process and biological process this GO :0019773 and proteasome core complex, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000209 and protein polyubiquitination and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0000502 and proteasome complex and cellular component this GO :0000932 and cytoplasmic mRNA processing body and cellular component this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0004298 : threonine-type endopeptidase activity and also this GO :0005515 : protein binding, this GO :0004298 : threonine-type endopeptidase activity, this GO :0005515 : protein binding, proteasome (prosome
Identity: 9531
Gene: PSMA2 | More about : PSMA2
Long gene name: proteasome subunit alpha 2
Synonyms gene name: 2 , alpha type, macropain) subunit, proteasome (prosome
Synonyms: MU HC3 PMSA2
Locus: 7p14, 1
Discovery year: 1995-05-03
GenBank acession: D00760
Entrez gene record: 5683
Pubmed identfication: 2025653 1888762
RefSeq identity: NM_002787
Classification: Proteasome
Havana BLAST/BLAT: OTTHUMG00000023916

Related Products :

R32556 PSMA2 Antibody / Proteasome 20S alpha 2 0.1mg 406 € NJS poly human
EKU02019 20S-Proteasome (20S-PSM) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU02020 20S-Proteasome (20S-PSM) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
abx575959 Anti-Human 20S-Proteasome (20S-PSM) ELISA Kit 96 tests 789 € abbex human
abx575726 Anti-Mouse 20S-Proteasome (20S-PSM) ELISA Kit inquire 50 € abbex mouse
DL-20S-PSM-Hu Human 20S-Proteasome 20S-PSM ELISA Kit 96T 904 € DL elisas human
DL-20S-PSM-Mu Mouse 20S-Proteasome 20S-PSM ELISA Kit 96T 921 € DL elisas mouse
MBS610430 Proteasome 19S Subunit S1 (26S Proteasome Non-ATPase Regulatory Subunit 1, 26S Proteasome Regulatory Subunit RPN2, 26S Proteasome Regulatory Subunit S1, 26S Proteasome Subunit p112, MGC133040, MGC133041, P112, Proteasome (Prosome, Macropain) 26S Subunit N Antibody 100ug 735 € MBS Polyclonals_1 human
MBS614271 Proteasome 19S Subunit S5b (Proteasome 19S S5B, 26S Protease Subunit S5 Basic, 26S Proteasome Non-ATPase Regulatory Subunit 5, 26S Proteasome Subunit S5B, KIAA0072, MGC23145, Proteasome (Prosome, Macropain) 26S Subunit Non-ATPase 5, PSMD5, S5B) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620385 Proteasome 26S Non-ATPase Subunit 2 (Proteasome (Prosome, Macropain) 26S Subunit Non-ATPase 2, Proteasome 26S Subunit Non-ATPase 2, PSMD2, 26S Proteasome Non-ATPase Regulatory Subunit 2, 26S Proteasome Regulatory Subunit RPN1, 26S Proteasome Regulatory Su Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58b864934903a Carassius auratus Proteasome subunit alpha type-2 (psma2) 100ug 1702 € MBS Recombinant Proteins human
GENTAUR-58b86493a3119 Carassius auratus Proteasome subunit alpha type-2 (psma2) 1000ug 1702 € MBS Recombinant Proteins human
GENTAUR-58b864941c353 Carassius auratus Proteasome subunit alpha type-2 (psma2) 100ug 2210 € MBS Recombinant Proteins human
GENTAUR-58b8649477858 Carassius auratus Proteasome subunit alpha type-2 (psma2) 1000ug 2210 € MBS Recombinant Proteins human
MBS274674 Proteasome 20S alpha 1 antibody [N1C3] 100ul 426 € MBS Polyclonals_1 human
MBS837464 Proteasome 20S alpha 2 antibody 100ul 630 € MBS Polyclonals_1 human
bs-9351R-A350 Proteasome 20S alpha 2 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9351R-A488 Proteasome 20S alpha 2 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9351R-A555 Proteasome 20S alpha 2 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9351R-A594 Proteasome 20S alpha 2 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9351R-A647 Proteasome 20S alpha 2 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9351R-Biotin Proteasome 20S alpha 2 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9351R Proteasome 20S alpha 2 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-9351R-Cy3 Proteasome 20S alpha 2 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9351R-Cy5 Proteasome 20S alpha 2 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9351R-Cy5.5 Proteasome 20S alpha 2 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9351R-Cy7 Proteasome 20S alpha 2 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9351R-FITC Proteasome 20S alpha 2 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9351R-HRP Proteasome 20S alpha 2 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS270266 Proteasome 20S alpha 2 antibody [N1C3] 100ul 426 € MBS Polyclonals_1 human