| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
BDKRB2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This BDKRB2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P30411 |
| Purity: |
Antigen affinity |
| Description: |
Alternate start codons result in two isoforms of the protein, The 9 aa bradykinin peptide elicits many responses including vasodilation, This gene encodes a receptor for bradykinin, This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system, edema, encoded by the BDKRB2 gene in humans, smooth muscle spasm and pain fiber stimulation, Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin |
| Immunogen: |
Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the BDKRB2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
nuclear, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
BDKRB2 |
| Short name: |
BDKRB2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
bradykinin receptor B2 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
B2R and BK-2 and BK2 and BKR2 and BRB2, BDKRB2 and IDBG-18990 and ENSG00000168398 and 624, BT, Bdkrb2 and IDBG-169186 and ENSMUSG00000021070 and 12062, Plasma membranes, protein heterodimerization activity, this GO :0002020 and protease binding and molecular function this GO :0004435 and phosphatidylinositol phospholipase C activity and molecular function this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0004947 and bradykinin receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006939 and smooth muscle contraction and biological process this GO :0006954 and inflammatory response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0008015 and blood circulation and biological process this GO :0008152 and metabolic process and biological process this GO :0009651 and response to salt stress and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0019229 and regulation of vasoconstriction and biological process this GO :0031702 and type 1 angiotensin receptor binding and molecular function this GO :0033137 and negative regulation of peptidyl-serine phosphorylation and biological process this GO :0042310 and vasoconstriction and biological process this GO :0042311 and vasodilation and biological process this GO :0043114 and regulation of vascular permeability and biological process this GO :0045087 and innate immune response and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0050482 and arachidonic acid secretion and biological process this GO :1902219 and negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress and biological process this GO :1902239 and negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0004435 : phosphatidylinositol phospholipase C activity and also this GO :0004930 : G-protein coupled receptor activity and also this GO :0004947 : bradykinin receptor activity and also this GO :0005515 : protein binding and also this GO :0031702 : type 1 angiotensin receptor binding and also this GO :0046982 : protein heterodimerization activity, this GO :0004435 : phosphatidylinositol phospholipase C activity, this GO :0004930 : G-protein coupled receptor activity, this GO :0004947 : bradykinin receptor activity, this GO :0005515 : protein binding, this GO :0031702 : type 1 angiotensin receptor binding, this GO :0046982 : protein heterodimerization activity, 72991 and IDBG-634176 and ENSBTAG00000021717 and 538896, bradykinin receptor B2 |
| Identity: |
1030 |
| Gene: |
BDKRB2 |
More about : BDKRB2 |
| Long gene name: |
bradykinin receptor B2 |
| Synonyms: |
BK-2 |
| Locus: |
14q32, 2 |
| Discovery year: |
1993-04-07 |
| GenBank acession: |
S56772 |
| Entrez gene record: |
624 |
| Pubmed identfication: |
7916737 |
| Classification: |
Bradykinin receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000171408 |