BDKRB2 Antibody

Contact us
Catalog number: R32515
Price: 528 €
Supplier: abbex
Product name: BDKRB2 Antibody
Quantity: 15 nmol
Other quantities: 0.1ml 263€ 1 vial 411€ 100ug 387€ 200ug 558€ 50ug 304€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: BDKRB2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This BDKRB2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P30411
Purity: Antigen affinity
Description: Alternate start codons result in two isoforms of the protein, The 9 aa bradykinin peptide elicits many responses including vasodilation, This gene encodes a receptor for bradykinin, This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system, edema, encoded by the BDKRB2 gene in humans, smooth muscle spasm and pain fiber stimulation, Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin
Immunogen: Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the BDKRB2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: nuclear, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: BDKRB2
Short name: BDKRB2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: bradykinin receptor B2 (Antibody to)
Alternative technique: antibodies
Alternative to gene target: B2R and BK-2 and BK2 and BKR2 and BRB2, BDKRB2 and IDBG-18990 and ENSG00000168398 and 624, BT, Bdkrb2 and IDBG-169186 and ENSMUSG00000021070 and 12062, Plasma membranes, protein heterodimerization activity, this GO :0002020 and protease binding and molecular function this GO :0004435 and phosphatidylinositol phospholipase C activity and molecular function this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0004947 and bradykinin receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006939 and smooth muscle contraction and biological process this GO :0006954 and inflammatory response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0008015 and blood circulation and biological process this GO :0008152 and metabolic process and biological process this GO :0009651 and response to salt stress and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0019229 and regulation of vasoconstriction and biological process this GO :0031702 and type 1 angiotensin receptor binding and molecular function this GO :0033137 and negative regulation of peptidyl-serine phosphorylation and biological process this GO :0042310 and vasoconstriction and biological process this GO :0042311 and vasodilation and biological process this GO :0043114 and regulation of vascular permeability and biological process this GO :0045087 and innate immune response and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0050482 and arachidonic acid secretion and biological process this GO :1902219 and negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress and biological process this GO :1902239 and negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0004435 : phosphatidylinositol phospholipase C activity and also this GO :0004930 : G-protein coupled receptor activity and also this GO :0004947 : bradykinin receptor activity and also this GO :0005515 : protein binding and also this GO :0031702 : type 1 angiotensin receptor binding and also this GO :0046982 : protein heterodimerization activity, this GO :0004435 : phosphatidylinositol phospholipase C activity, this GO :0004930 : G-protein coupled receptor activity, this GO :0004947 : bradykinin receptor activity, this GO :0005515 : protein binding, this GO :0031702 : type 1 angiotensin receptor binding, this GO :0046982 : protein heterodimerization activity, 72991 and IDBG-634176 and ENSBTAG00000021717 and 538896, bradykinin receptor B2
Identity: 1030
Gene: BDKRB2 | More about : BDKRB2
Long gene name: bradykinin receptor B2
Synonyms: BK-2
Locus: 14q32, 2
Discovery year: 1993-04-07
GenBank acession: S56772
Entrez gene record: 624
Pubmed identfication: 7916737
Classification: Bradykinin receptors
Havana BLAST/BLAT: OTTHUMG00000171408

Related Products :

AP32712SU-N anti-BDKRB2 Antibody 0,1 ml 442 € acr human
AP32713PU-N anti-BDKRB2 Antibody 0,1 mg 500 € acr human
GENTAUR-58bdeb8e530cd Anti- BDKRB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdeb8ea2cad Anti- BDKRB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf292656cd Anti- BDKRB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf292df4d5 Anti- BDKRB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be15a57d212 Anti- BDKRB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be15a5e756d Anti- BDKRB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3daf209f3 Anti- BDKRB2 Antibody 100ug 393 € MBS Polyclonals human
RA14137-100 anti-BDKRB2 Antibody 0,1 ml 442 € acr human
abx148585 Anti-BDKRB2 Antibody 200 μg 369 € abbex human
SP4078P anti-BDKRB2 (C-term) Antibody 50 Вµg 732 € acr human
GWB-A9A474 BDKRB2 antibody 1 vial 411 € genways human
MBS127266 BDKRB2 Antibody 50ug 304 € MBS Polyclonals_1 human
R32515 BDKRB2 Antibody 0.1mg 406 € NJS poly human
bs-2422R-A350 Bdkrb2 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2422R-A488 Bdkrb2 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2422R-A555 Bdkrb2 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2422R-A594 Bdkrb2 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2422R-A647 Bdkrb2 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2422R-Biotin Bdkrb2 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2422R Bdkrb2 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-2422R-Cy3 Bdkrb2 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2422R-Cy5 Bdkrb2 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2422R-Cy5.5 Bdkrb2 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2422R-Cy7 Bdkrb2 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2422R-FITC Bdkrb2 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2422R-HRP Bdkrb2 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58be609dbd194 Anti-Bdkrb2 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx900618 Anti-BDKRB2 siRNA 15 nmol 528 € abbex human