ACCN1 Antibody / ASIC2

Contact us
Catalog number: R32514
Price: 920 €
Supplier: genways
Product name: ACCN1 Antibody / ASIC2
Quantity: 1 tube
Other quantities: 0.08 ml 199€ 0.4 ml 406€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ACCN1 / ASIC2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This ACCN1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q16515
Purity: Antigen affinity
Description: 2 hydrophobic transmembrane regions, Alternative splicing has been observed at this locus and two variants, In addition, The member encoded by this gene may play a role in neurotransmission, The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium, also known as ASIC2, and a large extracellular loop, encoding distinct isoforms, have been identified, is a protein that in humans is encoded by the ACCN1 gene, neuronal, which has many cysteine residues with conserved spacing, Amiloride-sensitive cation channel 1
Immunogen: Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACCN1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ACCN1 / ASIC2
Short name: ACCN1 Antibody / ASIC2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ACCN1 (Antibody to) / ASIC2
Alternative technique: antibodies
Identity: 99
Gene: ASIC2 | More about : ASIC2
Long gene name: acid sensing ion channel subunit 2
Synonyms gene: ACCN ACCN1
Synonyms gene name: amiloride-sensitive cation channel 1, neuronal acid-sensing (proton-gated) ion channel 2
Synonyms: ASIC2a BNC1 BNaC1 hBNaC1 MDEG
Synonyms name: degenerin
Locus: 17q11, 2-q12
Discovery year: 1997-05-22
GenBank acession: AL834182
Entrez gene record: 40
Pubmed identfication: 8921408
RefSeq identity: NM_183377 NM_001094
Classification: Acid sensing ion channel subunits
Havana BLAST/BLAT: OTTHUMG00000132885

Related Products :

F51596-0.08ML ACCN1 Antibody / ASIC2 0.08 ml 199 € NJS poly human
F51596-0.4ML ACCN1 Antibody / ASIC2 0.4 ml 406 € NJS poly human
R32514 ACCN1 Antibody / ASIC2 0.1mg 406 € NJS poly human
AP50043PU-N anti-ASIC2 / ACCN1 (Center) Antibody 0,4 ml 587 € acr human
MBS610771 ASIC2 (Acid Sensitive Ion Channel 2, BNaC1, Brain Sodium Channel 1, BNC1, MDEG1, Mammalian Degenerin1, Amiloride-Sensitive Neuronal Cation Channel 1, Accn1) Antibody 0.05 ml 580 € MBS Polyclonals_1 human
GWB-71D6D6 ACCN1 antibody 1 tube 486 € genways human
GENTAUR-58be0600c82af Anti- ACCN1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0601272e3 Anti- ACCN1 Antibody 0.12 ml 348 € MBS Polyclonals human
MBS614034 Mammalian Degenerin 1 (MDGE1, ASIC2, BNaC1) Antibody 50ug 492 € MBS Polyclonals_1 human
GWB-7F0D13 ACCN1 Over-expression Lysate reagent 1 volume 463 € genways human
abx900477 Anti-ASIC2 siRNA 30 nmol 717 € abbex human
abx908340 Anti-ASIC2 siRNA 30 nmol 717 € abbex human
abx908341 Anti-ASIC2 siRNA 30 nmol 717 € abbex human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human
GWB-6B2DC9 antibody to or anti- Control Immune Serum goat antibody to or anti- peptide sequence Carrier antibody 1 tube 729 € genways human
GWB-BE9688 antibody to or anti- Estrone-6 antibody antibody 1 vial 1041 € genways human
GWB-4AF2C3 antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 x 1 vial 1104 € genways human
GWB-535489 antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 x 1 vial 786 € genways human
GWB-90430B antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 vial 983 € genways human
GWB-A0527F antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 vial 602 € genways human
GWB-4F4BE7 antibody to or anti- Goat antibody to or anti-Type I Collagen antibody 1 x 1 vial 920 € genways human
GWB-C8DE8D antibody to or anti- Goat antibody to or anti-Type I Collagen antibody 1 vial 694 € genways human
GWB-388880 antibody to or anti- Goat antibody to or anti-Type II Collagen antibody 1 x 1 vial 920 € genways human
GWB-E202A8 antibody to or anti- Goat antibody to or anti-Type II Collagen antibody 1 vial 694 € genways human
GWB-6573A5 antibody to or anti- Goat antibody to or anti-Type III Collagen antibody 1 tube 920 € genways human