| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ACCN1 / ASIC2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This ACCN1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q16515 |
| Purity: |
Antigen affinity |
| Description: |
2 hydrophobic transmembrane regions, Alternative splicing has been observed at this locus and two variants, In addition, The member encoded by this gene may play a role in neurotransmission, The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium, also known as ASIC2, and a large extracellular loop, encoding distinct isoforms, have been identified, is a protein that in humans is encoded by the ACCN1 gene, neuronal, which has many cysteine residues with conserved spacing, Amiloride-sensitive cation channel 1 |
| Immunogen: |
Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACCN1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ACCN1 / ASIC2 |
| Short name: |
ACCN1 Antibody / ASIC2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
ACCN1 (Antibody to) / ASIC2 |
| Alternative technique: |
antibodies |
| Identity: |
99 |
| Gene: |
ASIC2 |
More about : ASIC2 |
| Long gene name: |
acid sensing ion channel subunit 2 |
| Synonyms gene: |
ACCN ACCN1 |
| Synonyms gene name: |
amiloride-sensitive cation channel 1, neuronal acid-sensing (proton-gated) ion channel 2 |
| Synonyms: |
ASIC2a BNC1 BNaC1 hBNaC1 MDEG |
| Synonyms name: |
degenerin |
| Locus: |
17q11, 2-q12 |
| Discovery year: |
1997-05-22 |
| GenBank acession: |
AL834182 |
| Entrez gene record: |
40 |
| Pubmed identfication: |
8921408 |
| RefSeq identity: |
NM_183377 NM_001094 |
| Classification: |
Acid sensing ion channel subunits |
| Havana BLAST/BLAT: |
OTTHUMG00000132885 |