ABP1 Antibody / Amiloride binding protein 1

Catalog number:	R32508 Buy Now
Price:	350 €
Supplier:	Bioss Primary Conjugated Antibodies
Product name:	ABP1 Antibody / Amiloride binding protein 1
Quantity:	0.1ml
Other quantities:	0.08 ml 199€ 0.4 ml 406€
Related search:	abp gene amiloride antibodies synonyms oxidase copper

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	ABP1 / Amiloride binding protein 1
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	5-1ug/ml, Western blot: 0
Added buffer:	025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use:	This ABP1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	P19801
Purity:	Antigen affinity
Description:	Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, Catalyzes the degradation of compounds such as putrescine, Placental DAO is thought to play a role in the regulation of the female reproductive function, The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels, and possibly apoptosis, and related compounds, and spermidine, cell proliferation, histamine, histamine, spermine, substances involved in allergic and immune responses, tissue differentiation, tumor formation, The AOC1 encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine
Immunogen:	Amino acids 144-180 (STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR) from the human protein were used as the immunogen for the ABP1 antibody
Storage:	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ABP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization:	membranous, Cytoplasmic
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	ABP1 / Amiloride binding protein 1
Short name:	ABP1 Antibody / Amiloride binding protein 1
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	ABP1 (Antibody to) / Amiloride binding protein 1
Alternative technique:	antibodies
Identity:	80
Gene:	AOC1 | More about : AOC1
Long gene name:	amine oxidase, copper containing 1
Synonyms gene:	ABP1
Synonyms gene name:	amiloride binding protein 1 (amine oxidase (copper-containing))
Synonyms:	DAO
Synonyms name:	diamine oxidase
Locus:	7q36, 1
Discovery year:	1991-05-06
GenBank acession:	AK092514
Entrez gene record:	26
Pubmed identfication:	8182053
RefSeq identity:	NM_001091
Havana BLAST/BLAT:	OTTHUMG00000158306

• #abp
• #gene
• #amiloride
• #antibodies
• #synonyms
• #oxidase
• #copper