ALDH7A1 Antibody

Contact us
Catalog number: R32506
Price: 1116 €
Supplier: MBS Recombinant Proteins
Product name: ALDH7A1 Antibody
Quantity: 1000ug
Other quantities: 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ALDH7A1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This ALDH7A1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P49419
Purity: Antigen affinity
Description: An additional variant encoding a different isoform has also been found for this gene, It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix, Mutations in this gene are associated with pyridoxine-dependent epilepsy, Recent reports show that this protein is found both in the cytosol and the mitochondria, Several related pseudogenes have also been identified, The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family, These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation, This particular member has homology to a previously described protein from the green garden pea, also known as ALDH7A1 or antiquitin, and the two forms likely arise from the use of alternative translation initiation sites, is an enzyme that in humans is encoded by the ALDH7A1 gene, member A1, the 26g pea turgor protein, Aldehyde dehydrogenase 7 family
Immunogen: Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ALDH7A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ALDH7A1
Short name: ALDH7A1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ALDH7A1 (Antibody to)
Alternative technique: antibodies
Identity: 877
Gene: ALDH7A1 | More about : ALDH7A1
Long gene name: aldehyde dehydrogenase 7 family member A1
Synonyms gene: ATQ1
Synonyms gene name: aldehyde dehydrogenase 7 family, member A1
Synonyms: EPD PDE
Synonyms name: antiquitin 1 26g turgor protein homolog alpha-aminoadipic semialdehyde dehydrogenase alpha-AASA dehydrogenase delta1-piperideine-6-carboxylate dehydrogenease P6c dehydrogenase
Locus: 5q23, 2
Discovery year: 1995-12-11
GenBank acession: S74728
Entrez gene record: 501
Pubmed identfication: 9417906
RefSeq identity: NM_001182
Classification: Aldehyde dehydrogenases
Havana BLAST/BLAT: OTTHUMG00000128942
Locus Specific Databases: BIOMBD

Related Products :

GWB-MV004D ALDH7A1 antibody 1 vial 521 € genways human
R32506 ALDH7A1 Antibody 0.1mg 406 € NJS poly human
GENTAUR-58bdc95f3cbd5 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc95fa5be1 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcbb7003f1 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcbb759ac7 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcc19dfe49 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdccd633834 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdccd6a6603 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcee5cad4e Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcf5ee9878 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd707a776c Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd9d2bc657 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd9fab6a75 Anti- Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58be10915ec08 Anti- ALDH7A1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be1091bdb87 Anti- ALDH7A1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be31995d05e Anti- ALDH7A1 Antibody 100ug 658 € MBS Polyclonals human
GENTAUR-58bce18807066 Acanthopagrus schlegelii Alpha-aminoadipic semialdehyde dehydrogenase (aldh7a1) 1000ug 1105 € MBS Recombinant Proteins human
GENTAUR-58bce18857801 Acanthopagrus schlegelii Alpha-aminoadipic semialdehyde dehydrogenase (aldh7a1) 1000ug 1614 € MBS Recombinant Proteins human
LV072901 ALDH7A1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV072902 ALDH7A1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV072903 ALDH7A1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV072904 ALDH7A1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV072906 ALDH7A1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 600 € ABM lentivectors human
LV072905 ALDH7A1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 600 € ABM lentivectors human
GWB-FCF172 ALDH7A1 Over-expression Lysate reagent 1 vial 463 € genways human
abx900280 Anti-ALDH7A1 siRNA inquire 50 € abbex human
abx907250 Anti-ALDH7A1 siRNA inquire 50 € abbex human
abx907251 Anti-ALDH7A1 siRNA 30 nmol 717 € abbex human
GENTAUR-58ba6b223a023 Ctenopharyngodon idella Alpha-aminoadipic semialdehyde dehydrogenase (aldh7a1) 1000ug 1116 € MBS Recombinant Proteins human