ALDH1B1 Antibody

Catalog number:	R32505 Buy Now
Price:	322 €
Supplier:	ABM lentivectors
Product name:	ALDH1B1 Antibody
Quantity:	1.0 µg DNA
Other quantities:	0.1mg 406€ 0.1ml 263€ 1 vial 521€
Related search:	aldhb gene aldehyde antibodies dehydrogenase synonyms details

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	ALDH1B1
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	5-1ug/ml, Western blot: 0
Added buffer:	025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use:	This ALDH1B1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	P30837
Purity:	Antigen affinity
Description:	Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism, The variation of this locus may affect the development of alcohol-related problems, This gene does not contain introns in the coding sequence, This protein belongs to the aldehyde dehydrogenases family of proteins, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene, Aldehyde dehydrogenase X
Immunogen:	Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody
Storage:	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ALDH1B1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization:	granular, Cytoplasmic
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	ALDH1B1
Short name:	ALDH1B1 Antibody
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	ALDH1B1 (Antibody to)
Alternative technique:	antibodies
Identity:	407
Gene:	ALDH1B1 | More about : ALDH1B1
Long gene name:	aldehyde dehydrogenase 1 family member B1
Synonyms gene:	ALDH5
Synonyms gene name:	aldehyde dehydrogenase 1 family, member B1
Synonyms:	ALDHX
Locus:	9p13, 1
Discovery year:	1992-02-13
GenBank acession:	M63967
Entrez gene record:	219
Pubmed identfication:	2061311
Classification:	Aldehyde dehydrogenases
Havana BLAST/BLAT:	OTTHUMG00000019938

• #aldhb
• #gene
• #aldehyde
• #antibodies
• #dehydrogenase
• #synonyms
• #details