| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
AK1 / Adenylate Kinase 1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This AK1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P00568 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing of this gene results in multiple transcript variants encoding different isoforms, Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia, This gene is highly expressed in skeletal muscle, brain and erythrocytes, This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments |
| Immunogen: |
Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the AK1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
AK1 / Adenylate Kinase 1 |
| Short name: |
AK1 Antibody / Adenylate Kinase 1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
AK1 (Antibody to) / Adenylate phosphorylation catalyst 1 |
| Alternative technique: |
antibodies |
| Identity: |
361 |
| Gene: |
AK1 |
More about : AK1 |
| Long gene name: |
adenylate kinase 1 |
| Locus: |
9q34, 11 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
J04809 |
| Entrez gene record: |
203 |
| Classification: |
Adenylate kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000020722 |