AK1 Antibody / Adenylate Kinase 1

Contact us
Catalog number: R32501
Price: 671 €
Supplier: abebio
Product name: AK1 Antibody / Adenylate Kinase 1
Quantity: 1x plate of 96 wells
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AK1 / Adenylate Kinase 1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This AK1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P00568
Purity: Antigen affinity
Description: Alternative splicing of this gene results in multiple transcript variants encoding different isoforms, Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia, This gene is highly expressed in skeletal muscle, brain and erythrocytes, This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments
Immunogen: Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the AK1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AK1 / Adenylate Kinase 1
Short name: AK1 Antibody / Adenylate Kinase 1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: AK1 (Antibody to) / Adenylate phosphorylation catalyst 1
Alternative technique: antibodies
Identity: 361
Gene: AK1 | More about : AK1
Long gene name: adenylate kinase 1
Locus: 9q34, 11
Discovery year: 1986-01-01
GenBank acession: J04809
Entrez gene record: 203
Classification: Adenylate kinases
Havana BLAST/BLAT: OTTHUMG00000020722

Related Products :

MBS623800 Adenylate Kinase 1, CT (Adenylate Kinase Isoenzyme 1, AK 1, AK1, AK-1, Adenylate Kinase Soluble, ATP-AMP Transphosphorylase, Myokinase) Antibody 200ul 603 € MBS Polyclonals_1 human
R32501 AK1 Antibody / Adenylate Kinase 1 0.1mg 406 € NJS poly human
AR09708PU-L anti-Adenylate kinase 1 / AK1 (1-194, His-tag) Antibody 0,5 mg 1138 € acr human
AR09708PU-N anti-Adenylate kinase 1 / AK1 (1-194, His-tag) Antibody 0,1 mg 485 € acr human
AP21348AF-N anti-Adenylate kinase 1 / AK1 Antibody 10 mg 398 € acr human
AP21348BT-N anti-Adenylate kinase 1 / AK1 Antibody 1 ml 558 € acr human
AP21349AF-N anti-Adenylate kinase 1 / AK1 Antibody 10 mg 398 € acr human
AP21349BT-N anti-Adenylate kinase 1 / AK1 Antibody 1 ml 630 € acr human
AP21349PU-N anti-Adenylate kinase 1 / AK1 Antibody 1 mg 688 € acr human
AP32254PU-N anti-Adenylate kinase 1 / AK1 Antibody 50 Вµg 732 € acr human
C10259-1 anti-Adenylate kinase 1 / AK1 Antibody 50 Вµg 347 € acr human
C10259-2 anti-Adenylate kinase 1 / AK1 Antibody 0,1 mg 500 € acr human
AP15163PU-N anti-Adenylate kinase 1 / AK1 (C-term) Antibody 0,4 ml 587 € acr human
AP15162PU-N anti-Adenylate kinase 1 / AK1 (N-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58b3827b9013a Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 100ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b3827bbda42 Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 1000ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b3827c0e721 Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 100ug 2111 € MBS Recombinant Proteins human
GENTAUR-58b3827c38eae Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 1000ug 2111 € MBS Recombinant Proteins human
GENTAUR-58b43bf324e75 Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 100ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b43bf36a7d9 Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 1000ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b43bf41a33d Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 100ug 2111 € MBS Recombinant Proteins human
GENTAUR-58b43bf4819d8 Cyprinus carpio Adenylate kinase isoenzyme 1 (ak1) 1000ug 2111 € MBS Recombinant Proteins human
AE19275RB-48 ELISA test for Rabbit Adenylate kinase isoenzyme 1 (AK1) 1x plate of 48 wells 402 € abebio human
AE19276RA-48 ELISA test for Rat Adenylate kinase isoenzyme 1 (AK1) 1x plate of 48 wells 373 € abebio rat
GENTAUR-58bcbaa7e3fb7 Mesocricetus auratus Adenylate kinase isoenzyme 1 (AK1) 100ug 1266 € MBS Recombinant Proteins human
GENTAUR-58bcbaa83b61b Mesocricetus auratus Adenylate kinase isoenzyme 1 (AK1) 1000ug 1266 € MBS Recombinant Proteins human
GENTAUR-58bcbaa8847e3 Mesocricetus auratus Adenylate kinase isoenzyme 1 (AK1) 100ug 1768 € MBS Recombinant Proteins human
GENTAUR-58bcbaa8de56a Mesocricetus auratus Adenylate kinase isoenzyme 1 (AK1) 1000ug 1768 € MBS Recombinant Proteins human
MBS242780 PAb (IgG) to Human AK1 / Adenylate Kinase 1 50ug 597 € MBS Polyclonals_1 human
AE19275RB-96 Rabbit Adenylate kinase isoenzyme 1 (AK1) ELISA Kit 1x plate of 96 wells 671 € abebio human