ACTN3 Antibody

Contact us
Catalog number: R32494
Price: 869 €
Supplier: DL elisas
Product name: ACTN3 Antibody
Quantity: 96T
Other quantities: 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ACTN3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This ACTN3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q08043
Purity: Antigen affinity
Description: An allelic polymorphism in this gene results in both coding and non-coding variants, The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line, The non-functional allele of this gene is associated with elite athlete status, This gene encodes a member of the alpha-actin binding protein gene family, This protein is involved in crosslinking actin containing thin filaments, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene, the reference genome represents the coding allele, Alpha-actinin-3
Immunogen: Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACTN3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ACTN3
Short name: ACTN3 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: a 3 (gene/pseudogene) (Antibody to), actinin
Alternative technique: antibodies
Alternative to gene target: ACTN3 and IDBG-409425 and ENSG00000248746 and 89, ACTN3 and IDBG-644440 and ENSBTAG00000022244 and 539375, Actn3 and IDBG-130128 and ENSMUSG00000006457 and 11474, Cell surfaces, actin filament binding, alpha 3 (gene/pseudogene), this GO :0003779 and actin binding and molecular function this GO :0005178 and integrin binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0005884 and actin filament and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0006936 and muscle contraction and biological process this GO :0008307 and structural constituent of muscle and molecular function this GO :0030017 and sarcomere and cellular component this GO :0030018 and Z disc and cellular component this GO :0030049 and muscle filament sliding and biological process this GO :0031143 and pseudopodium and cellular component this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0048041 and focal adhesion assembly and biological process this GO :0051015 and actin filament binding and molecular function, this GO :0003779 : actin binding, this GO :0003779 : actin binding and also this GO :0005178 : integrin binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008307 : structural constituent of muscle and also this GO :0042803 : protein homodimerization activity and also this GO :0051015 : actin filament binding, this GO :0005178 : integrin binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008307 : structural constituent of muscle, this GO :0042803 : protein homodimerization activity, this GO :0051015 : actin filament binding, actinin
Identity: 165
Gene: ACTN3 | More about : ACTN3
Long gene name: actinin alpha 3 (gene/pseudogene)
Synonyms gene name: actinin, alpha 3
Locus: 11q13, 2
Discovery year: 1991-07-16
GenBank acession: M86407
Entrez gene record: 89
Pubmed identfication: 1339456
RefSeq identity: NM_001104
Classification: Actinins
Havana BLAST/BLAT: OTTHUMG00000160815

Related Products :

GWB-MN989H ACTN3 antibody 1 vial 521 € genways human
R32494 ACTN3 Antibody 0.1mg 406 € NJS poly human
A03A0064 anti-ACTN3 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdf82f1f555 Anti- ACTN3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf82f76905 Anti- ACTN3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0a4b7fbea Anti- ACTN3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0a4c005ca Anti- ACTN3 Antibody 0.06 ml 265 € MBS Polyclonals human
abx147958 Anti-ACTN3 Antibody inquire 50 € abbex human
AP06785PU-N anti-Alpha-actinin-3 / ACTN3 Antibody 0,1 mg 558 € acr human
C12026-1 anti-Alpha-actinin-3 / ACTN3 Antibody 50 Вµg 347 € acr human
C12026-2 anti-Alpha-actinin-3 / ACTN3 Antibody 0,1 mg 500 € acr human
CPA1013-100ul anti-Alpha-actinin-3 / ACTN3 Antibody 0,1 ml 442 € acr human
CPA1013-200ul anti-Alpha-actinin-3 / ACTN3 Antibody 0,2 ml 688 € acr human
CPA1013-30ul anti-Alpha-actinin-3 / ACTN3 Antibody 30 Вµl 326 € acr human
AP50072PU-N anti-Alpha-actinin-3 / ACTN3 (Center) Antibody 0,4 ml 587 € acr human
AP23644PU-N anti-Alpha-actinin-3 / ACTN3 (N-term) Antibody 50 Вµg 732 € acr human
GWB-ASD997 Human ACTN3 Antibody bulk Ask price € genways bulk human
MBS242966 PAb (IgG) to Human ACTN3 Antibody 50ug 597 € MBS Polyclonals_1 human
EKU02097 Actinin Alpha 3 (ACTN3) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
LV067860 ACTN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV067861 ACTN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV067862 ACTN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV067863 ACTN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV067865 ACTN3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV067864 ACTN3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
abx906644 Anti-ACTN3 siRNA inquire 50 € abbex human
abx906645 Anti-ACTN3 siRNA 30 nmol 717 € abbex human
abx572173 Anti-Human Actinin Alpha 3 (ACTN3) ELISA Kit 96 tests 760 € abbex human
E-EL-Ch0159 Chicken ACTN3 (Actinin Alpha 3) ELISA Kit 96T 568 € elabsciences chicken
DL-ACTN3-Hu Human Actinin Alpha 3 ACTN3 ELISA Kit 96T 869 € DL elisas human