| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ACTN3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This ACTN3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q08043 |
| Purity: |
Antigen affinity |
| Description: |
An allelic polymorphism in this gene results in both coding and non-coding variants, The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line, The non-functional allele of this gene is associated with elite athlete status, This gene encodes a member of the alpha-actin binding protein gene family, This protein is involved in crosslinking actin containing thin filaments, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene, the reference genome represents the coding allele, Alpha-actinin-3 |
| Immunogen: |
Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACTN3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ACTN3 |
| Short name: |
ACTN3 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
a 3 (gene/pseudogene) (Antibody to), actinin |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
ACTN3 and IDBG-409425 and ENSG00000248746 and 89, ACTN3 and IDBG-644440 and ENSBTAG00000022244 and 539375, Actn3 and IDBG-130128 and ENSMUSG00000006457 and 11474, Cell surfaces, actin filament binding, alpha 3 (gene/pseudogene), this GO :0003779 and actin binding and molecular function this GO :0005178 and integrin binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0005884 and actin filament and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0006936 and muscle contraction and biological process this GO :0008307 and structural constituent of muscle and molecular function this GO :0030017 and sarcomere and cellular component this GO :0030018 and Z disc and cellular component this GO :0030049 and muscle filament sliding and biological process this GO :0031143 and pseudopodium and cellular component this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0048041 and focal adhesion assembly and biological process this GO :0051015 and actin filament binding and molecular function, this GO :0003779 : actin binding, this GO :0003779 : actin binding and also this GO :0005178 : integrin binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008307 : structural constituent of muscle and also this GO :0042803 : protein homodimerization activity and also this GO :0051015 : actin filament binding, this GO :0005178 : integrin binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008307 : structural constituent of muscle, this GO :0042803 : protein homodimerization activity, this GO :0051015 : actin filament binding, actinin |
| Identity: |
165 |
| Gene: |
ACTN3 |
More about : ACTN3 |
| Long gene name: |
actinin alpha 3 (gene/pseudogene) |
| Synonyms gene name: |
actinin, alpha 3 |
| Locus: |
11q13, 2 |
| Discovery year: |
1991-07-16 |
| GenBank acession: |
M86407 |
| Entrez gene record: |
89 |
| Pubmed identfication: |
1339456 |
| RefSeq identity: |
NM_001104 |
| Classification: |
Actinins |
| Havana BLAST/BLAT: |
OTTHUMG00000160815 |