| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ACADVL / VLCAD |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This ACADVL antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P49748 |
| Purity: |
Antigen affinity |
| Description: |
A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy, Alternative splicing results in multiple transcript variants encoding different isoforms, The protein encoded by this gene is targeted to the inner mitochondrial membrane, This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway, Very long-chain specific acyl-CoA dehydrogenase |
| Immunogen: |
Amino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACADVL antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ACADVL / VLCAD |
| Short name: |
ACADVL Antibody / VLCAD |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
ACADVL (Antibody to) / VLCAD |
| Alternative technique: |
antibodies |
| Identity: |
92 |
| Gene: |
ACADVL |
More about : ACADVL |
| Long gene name: |
acyl-CoA dehydrogenase, very long chain |
| Synonyms gene name: |
acyl-Coenzyme A dehydrogenase, very long chain |
| Synonyms: |
VLCAD LCACD ACAD6 |
| Locus: |
17p13, 1 |
| Discovery year: |
1996-05-30 |
| GenBank acession: |
BC012912 |
| Entrez gene record: |
37 |
| Pubmed identfication: |
8921384 |
| RefSeq identity: |
NM_000018 |
| Classification: |
Acyl-CoA dehydrogenase family |
| Havana BLAST/BLAT: |
OTTHUMG00000102157 |