| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ACAA2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This ACAA2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P42765 |
| Purity: |
Antigen affinity |
| Description: |
ACAA2 has been shown to be a functional BNIP3 binding partner, Additionally, The ACAA2 gene encodes a 41, The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral, Unlike most mitochondrial matrix proteins, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene, it contains a non-cleavable amino-terminal targeting signal, mitochondrial, which provides a possible link between fatty acid metabolism and cell apoptosis, 3-Ketoacyl-CoA thiolase, 9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides |
| Immunogen: |
Amino acids 207-242 (EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD from the human protein were used as the immunogen for the ACAA2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACAA2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ACAA2 |
| Short name: |
ACAA2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
ACAA2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
83 |
| Gene: |
ACAA2 |
More about : ACAA2 |
| Long gene name: |
acetyl-CoA acyltransferase 2 |
| Synonyms gene name: |
acetyl-Coenzyme A acyltransferase 2 |
| Synonyms: |
DSAEC |
| Synonyms name: |
mitochondrial 3-oxoacyl-Coenzyme A thiolase |
| Locus: |
18q21, 1 |
| Discovery year: |
1999-09-28 |
| GenBank acession: |
D16294 |
| Entrez gene record: |
10449 |
| Pubmed identfication: |
8241273 |
| RefSeq identity: |
NM_006111 |
| Havana BLAST/BLAT: |
OTTHUMG00000132667 |