ACAA2 Antibody

Contact us
Catalog number: R32490
Price: 402 €
Supplier: abebio
Product name: ACAA2 Antibody
Quantity: 1x plate of 48 wells
Other quantities: 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ACAA2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This ACAA2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P42765
Purity: Antigen affinity
Description: ACAA2 has been shown to be a functional BNIP3 binding partner, Additionally, The ACAA2 gene encodes a 41, The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral, Unlike most mitochondrial matrix proteins, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene, it contains a non-cleavable amino-terminal targeting signal, mitochondrial, which provides a possible link between fatty acid metabolism and cell apoptosis, 3-Ketoacyl-CoA thiolase, 9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides
Immunogen: Amino acids 207-242 (EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD from the human protein were used as the immunogen for the ACAA2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ACAA2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ACAA2
Short name: ACAA2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ACAA2 (Antibody to)
Alternative technique: antibodies
Identity: 83
Gene: ACAA2 | More about : ACAA2
Long gene name: acetyl-CoA acyltransferase 2
Synonyms gene name: acetyl-Coenzyme A acyltransferase 2
Synonyms: DSAEC
Synonyms name: mitochondrial 3-oxoacyl-Coenzyme A thiolase
Locus: 18q21, 1
Discovery year: 1999-09-28
GenBank acession: D16294
Entrez gene record: 10449
Pubmed identfication: 8241273
RefSeq identity: NM_006111
Havana BLAST/BLAT: OTTHUMG00000132667

Related Products :

GWB-MR100A ACAA2 antibody 1 vial 521 € genways human
R32490 ACAA2 Antibody 0.1mg 406 € NJS poly human
YSRTMCA5472Z ACAA2, Mouse Monoclonal antibody-; Clone: 2F7 0.1 mg Ask price € accurate-monoclonals mouse
PLA-010449-M01 ACAA2 Mouse Monoclonal Antibody (M01), clone 5C4 0.1mg 495 € Zyagen mouse
AR50844PU-N anti-ACAA2 (17-397, His-tag) Antibody 0,25 mg 1413 € acr human
AR50844PU-S anti-ACAA2 (17-397, His-tag) Antibody 50 Вµg 587 € acr human
AP45251PU-N anti-ACAA2 Antibody 50 Вµg 558 € acr human
GENTAUR-58bde9ade94f6 Anti- ACAA2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde9ae63e5c Anti- ACAA2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0402e725e Anti- ACAA2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be040367dca Anti- ACAA2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0e2747e0d Anti- ACAA2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0e27bef9e Anti- ACAA2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4a3780ed9 Anti- ACAA2 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be58577a6ad Anti- ACAA2 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be5857f3377 Anti- ACAA2 Antibody 50ug 365 € MBS Polyclonals human
abx147900 Anti-ACAA2 Antibody inquire 50 € abbex human
GWB-ATG148 ACAA2, 17-397aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
LV066468 ACAA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV066469 ACAA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV066470 ACAA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV066471 ACAA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV066473 ACAA2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV066472 ACAA2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GWB-B9E3C9 ACAA2 Over-expression Lysate reagent 1 vial 463 € genways human
abx900097 Anti-ACAA2 siRNA inquire 50 € abbex human
abx906442 Anti-ACAA2 siRNA inquire 50 € abbex human
abx906443 Anti-ACAA2 siRNA inquire 50 € abbex human
AE23275BO-96 Bovine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE23275BO-48 ELISA test for Bovine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) 1x plate of 48 wells 402 € abebio bovine