| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
CCR1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This CCR1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P51675 |
| Purity: |
Antigen affinity |
| Description: |
Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation, Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), This gene encodes a member of the beta chemokine receptor family, and myeloid progenitor inhibitory factor-1 (MPIF-1), and susceptibility to virus and parasite, monocyte chemoattractant protein 3 (MCP-3), regulated on activation normal T expressed and secreted protein (RANTES), which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors, C-C chemokine receptor type 1 is a protein that in humans is encoded by the CCR1 gene |
| Immunogen: |
Amino acids FVSAFQDVLFTNQCEQSKQLDLAMQVTEVIA from the mouse protein were used as the immunogen for the CCR1 antibody |
| Storage: |
After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the CCR1 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
CCR1 |
| Short name: |
CCR1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
chemokine (C-C motif) receptor 1 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
CCR1 and IDBG-30085 and ENSG00000163823 and 1230, CD191 and CKR-1 and CKR1 and CMKBR1 and HM145 and MIP1aR and SCYAR1, Cell surfaces, chemokine (C-C motif) ligand 5 binding, coupled to cyclic nucleotide second messenger and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008152 and metabolic process and biological process this GO :0009611 and response to wounding and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010629 and negative regulation of gene expression and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016493 and C-C chemokine receptor activity and molecular function this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019957 and C-C chemokine binding and molecular function this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0035717 and chemokine (C-C motif) ligand 7 binding and molecular function this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0051928 and positive regulation of calcium ion transport and biological process this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071791 and chemokine (C-C motif) ligand 5 binding and molecular function this GO :0090026 and positive regulation of monocyte chemotaxis and biological process, this GO :0002407 and dendritic cell chemotaxis and biological process this GO :0004435 and phosphatidylinositol phospholipase C activity and molecular function this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0004950 and chemokine receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006887 and exocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007187 and G-protein coupled receptor signaling pathway, this GO :0004435 : phosphatidylinositol phospholipase C activity, this GO :0004435 : phosphatidylinositol phospholipase C activity and also this GO :0004930 : G-protein coupled receptor activity and also this GO :0004950 : chemokine receptor activity and also this GO :0005515 : protein binding and also this GO :0016493 : C-C chemokine receptor activity and also this GO :0019957 : C-C chemokine binding and also this GO :0035717 : chemokine (C-C motif) ligand 7 binding and also this GO :0071791 : chemokine (C-C motif) ligand 5 binding, this GO :0004930 : G-protein coupled receptor activity, this GO :0004950 : chemokine receptor activity, this GO :0005515 : protein binding, this GO :0016493 : C-C chemokine receptor activity, this GO :0019957 : C-C chemokine binding, this GO :0035717 : chemokine (C-C motif) ligand 7 binding, this GO :0071791 : chemokine (C-C motif) ligand 5 binding, chemokine (C-C motif) receptor 1 |
| Identity: |
1602 |
| Gene: |
CCR1 |
More about : CCR1 |
| Long gene name: |
C-C motif chemokine receptor 1 |
| Synonyms gene: |
SCYAR1 CMKBR1 |
| Synonyms gene name: |
chemokine (C-C motif) receptor 1 |
| Synonyms: |
CKR-1 MIP1aR CD191 |
| Locus: |
3p21, 31 |
| Discovery year: |
1993-10-14 |
| Entrez gene record: |
1230 |
| Pubmed identfication: |
7679328 |
| RefSeq identity: |
NM_001295 |
| Classification: |
CD molecules C-C motif chemokine receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000133451 |