DDAH1 Antibody

Catalog number:	R32437 Buy Now
Price:	528 €
Supplier:	abbex
Product name:	DDAH1 Antibody
Quantity:	15 nmol
Other quantities:	0.1mg 406€ 0.1ml 263€ 1 vial 521€
Related search:	ddah antibody gene antibodies alternative sterile

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	DDAH1
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	2-4ug/ml (human), 5-1ug/ml (mouse/rat), Western blot: 0
Added buffer:	025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use:	This DDAH1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	O94760
Purity:	Antigen affinity
Description:	DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, It widely expressed, This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family, especially in liver and kidney, which in turn inhibit nitric oxide synthase activity, DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis
Immunogen:	Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN were used as the immunogen for the DDAH1 antibody
Storage:	After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the DDAH1 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	DDAH1
Short name:	DDAH1 Antibody
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	DDAH1 (Antibody to)
Alternative technique:	antibodies
Identity:	2715
Gene:	DDAH1 | More about : DDAH1
Long gene name:	dimethylarginine dimethylaminohydrolase 1
Synonyms:	DDAH
Locus:	1p22, 3
Discovery year:	1999-10-22
GenBank acession:	AB001915
Entrez gene record:	23576
Pubmed identfication:	9874257
Havana BLAST/BLAT:	OTTHUMG00000191181

• #ddah
• #antibody
• #gene
• #antibodies
• #alternative
• #sterile