| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GADD45A |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the GADD45A antibody should be determined by the researcher |
| Intented use: |
This GADD45A antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P24522 |
| Purity: |
Antigen affinity |
| Description: |
Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation, In addition, It is located on 1p34-p12, Northern blot analysis detected moderate expression of a 1, Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide, This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents, and kidney, and pancreas, liver, lung, placenta, skeletal muscle, with little or no expression in brain, 4-kb GADD45A transcript in heart, Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene |
| Immunogen: |
Amino acids VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER were used as the immunogen for the GADD45A antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GADD45A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GADD45A |
| Short name: |
GADD45A Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
a (Antibody to), growth arrest and Desoxyribonucleic acid-damage-inducible |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
DDIT1 and GADD45, GADD45A and IDBG-638096 and ENSBTAG00000013860 and 505463, GADD45A and IDBG-99580 and ENSG00000116717 and 1647, Gadd45a and IDBG-153723 and ENSMUSG00000036390 and 13197, alpha, nuclei, protein binding, this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0000185 and activation of MAPKKK activity and biological process this GO :0001047 and core promoter binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006281 and DNA repair and biological process this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006915 and apoptotic process and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007098 and centrosome cycle and biological process this GO :0042770 and signal transduction in response to DNA damage and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071479 and cellular response to ionizing radiation and biological process this GO :1900745 and positive regulation of p38MAPK cascade and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, this GO :0001047 : core promoter binding, this GO :0001047 : core promoter binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, growth arrest and DNA-damage-inducible |
| Identity: |
4095 |
| Gene: |
GADD45A |
More about : GADD45A |
| Long gene name: |
growth arrest and DNA damage inducible alpha |
| Synonyms gene: |
DDIT1 |
| Synonyms gene name: |
alpha , growth arrest and DNA-damage-inducible |
| Synonyms: |
GADD45 |
| Locus: |
1p31, 3 |
| Discovery year: |
1991-08-17 |
| GenBank acession: |
M60974 |
| Entrez gene record: |
1647 |
| Pubmed identfication: |
1990262 8226988 |
| RefSeq identity: |
NM_001924 |
| Havana BLAST/BLAT: |
OTTHUMG00000009374 |