GADD45A Antibody

Contact us
Catalog number: R32429
Price: 2039 €
Supplier: MBS Recombinant Proteins
Product name: GADD45A Antibody
Quantity: 100ug
Other quantities: 0.1mg 389€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: GADD45A
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the GADD45A antibody should be determined by the researcher
Intented use: This GADD45A antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P24522
Purity: Antigen affinity
Description: Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation, In addition, It is located on 1p34-p12, Northern blot analysis detected moderate expression of a 1, Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide, This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents, and kidney, and pancreas, liver, lung, placenta, skeletal muscle, with little or no expression in brain, 4-kb GADD45A transcript in heart, Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene
Immunogen: Amino acids VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER were used as the immunogen for the GADD45A antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GADD45A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: GADD45A
Short name: GADD45A Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: a (Antibody to), growth arrest and Desoxyribonucleic acid-damage-inducible
Alternative technique: antibodies
Alternative to gene target: DDIT1 and GADD45, GADD45A and IDBG-638096 and ENSBTAG00000013860 and 505463, GADD45A and IDBG-99580 and ENSG00000116717 and 1647, Gadd45a and IDBG-153723 and ENSMUSG00000036390 and 13197, alpha, nuclei, protein binding, this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0000185 and activation of MAPKKK activity and biological process this GO :0001047 and core promoter binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006281 and DNA repair and biological process this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006915 and apoptotic process and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007098 and centrosome cycle and biological process this GO :0042770 and signal transduction in response to DNA damage and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071479 and cellular response to ionizing radiation and biological process this GO :1900745 and positive regulation of p38MAPK cascade and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, this GO :0001047 : core promoter binding, this GO :0001047 : core promoter binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, growth arrest and DNA-damage-inducible
Identity: 4095
Gene: GADD45A | More about : GADD45A
Long gene name: growth arrest and DNA damage inducible alpha
Synonyms gene: DDIT1
Synonyms gene name: alpha , growth arrest and DNA-damage-inducible
Synonyms: GADD45
Locus: 1p31, 3
Discovery year: 1991-08-17
GenBank acession: M60974
Entrez gene record: 1647
Pubmed identfication: 1990262 8226988
RefSeq identity: NM_001924
Havana BLAST/BLAT: OTTHUMG00000009374

Related Products :

AR09458PU-L anti-GADD45A (1-165, His-tag) Antibody 0,5 mg 1022 € acr human
AR09458PU-N anti-GADD45A (1-165, His-tag) Antibody 0,1 mg 413 € acr human
BB-PA1402 anti-GADD45A Antibody 0,1 mg 471 € acr human
GENTAUR-58bdf29d1816a Anti- GADD45A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf29d5b854 Anti- GADD45A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf62531e3e Anti- GADD45A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf625916d4 Anti- GADD45A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0c443936b Anti- GADD45A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0c4489e39 Anti- GADD45A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0d1a9392d Anti- GADD45A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0d1b01849 Anti- GADD45A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3ce1b8752 Anti- GADD45A Antibody 100ug 393 € MBS Polyclonals human
abx146833 Anti-GADD45A Antibody inquire 50 € abbex human
abx146834 Anti-GADD45A Antibody 200 μg 369 € abbex human
AP18028PU-N anti-GADD45A (C-term) Antibody 0,4 ml 587 € acr human
AP12434PU-N anti-GADD45A (N-term) Antibody 0,4 ml 587 € acr human
GWB-MV873I GADD45A antibody 1 vial 521 € genways human
R30473 GADD45A Antibody 0.1mg 389 € NJS poly human
R32429 GADD45A Antibody 0.1mg 406 € NJS poly human
abx917465 Anti-GADD45A siRNA inquire 50 € abbex human
abx917466 Anti-GADD45A siRNA 30 nmol 717 € abbex human
abx151613 Anti-Human GADD45a ELISA Kit inquire 50 € abbex human
abx570889 Anti-Human GADD45a ELISA Kit inquire 50 € abbex human
abx155552 Anti-Rat GADD45a ELISA Kit 96 tests 1079 € abbex rat
abx570890 Anti-Rat GADD45a ELISA Kit 96 tests 905 € abbex rat
AE42768CA Cat Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) ELISA Kit 96 wells plate 810 € ab-elisa elisas cat
AE42768CA-96 Cat Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) ELISA Kit 1x plate of 96 wells 671 € abebio cat
GENTAUR-58bd074d129c9 Cricetulus griseus Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) 100ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bd074d67185 Cricetulus griseus Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) 1000ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bd074db5417 Cricetulus griseus Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) 100ug 2039 € MBS Recombinant Proteins human