| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Talin 2 / TLN2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Talin 2 antibody should be determined by the researcher |
| Intented use: |
This Talin 2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9Y4G6 |
| Purity: |
Antigen affinity |
| Description: |
It belongs to the talin protein family, Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally, This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts, Talin 2 is a protein in humans that is encoded by the TLN2 gene |
| Immunogen: |
Amino acids NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV were used as the immunogen for the Talin 2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Talin 2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Talin 2 / TLN2 |
| Short name: |
Talin 2 Antibody / TLN2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Talin 2 (Antibody to) / talin 2 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
Cell surfaces, TLN2 and IDBG-15260 and ENSG00000171914 and 83660, TLN2 and IDBG-646546 and ENSBTAG00000003667 and 528252, Tln2 and IDBG-180368 and ENSMUSG00000052698 and 70549, actin filament binding, this GO :0001726 and ruffle and cellular component this GO :0003779 and actin binding and molecular function this GO :0005158 and insulin receptor binding and molecular function this GO :0005198 and structural molecule activity and molecular function this GO :0005200 and structural constituent of cytoskeleton and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0005916 and fascia adherens and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0007016 and cytoskeletal anchoring at plasma membrane and biological process this GO :0007043 and cell-cell junction assembly and biological process this GO :0007155 and cell adhesion and biological process this GO :0015629 and actin cytoskeleton and cellular component this GO :0045202 and synapse and cellular component this GO :0051015 and actin filament binding and molecular function, this GO :0003779 : actin binding, this GO :0003779 : actin binding and also this GO :0005158 : insulin receptor binding and also this GO :0005198 : structural molecule activity and also this GO :0005200 : structural constituent of cytoskeleton and also this GO :0005515 : protein binding and also this GO :0051015 : actin filament binding, this GO :0005158 : insulin receptor binding, this GO :0005198 : structural molecule activity, this GO :0005200 : structural constituent of cytoskeleton, this GO :0005515 : protein binding, this GO :0051015 : actin filament binding, talin 2 |
| Identity: |
15447 |
| Gene: |
TLN2 |
More about : TLN2 |
| Long gene name: |
talin 2 |
| Synonyms: |
KIAA0320 ILWEQ |
| Locus: |
15q22, 2 |
| Discovery year: |
2001-04-25 |
| GenBank acession: |
AB002318 |
| Entrez gene record: |
83660 |
| Pubmed identfication: |
9205841 11527381 |
| Classification: |
FERM domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000133679 |