Talin 2 Antibody / TLN2

Contact us
Catalog number: R32413
Price: 608 €
Supplier: MBS mono
Product name: Talin 2 Antibody / TLN2
Quantity: 200ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Talin 2 / TLN2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (FFPE): 0, Western blot: 0
Notes: Optimal dilution of the Talin 2 antibody should be determined by the researcher
Intented use: This Talin 2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9Y4G6
Purity: Antigen affinity
Description: It belongs to the talin protein family, Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally, This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts, Talin 2 is a protein in humans that is encoded by the TLN2 gene
Immunogen: Amino acids NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV were used as the immunogen for the Talin 2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Talin 2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membranous, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Talin 2 / TLN2
Short name: Talin 2 Antibody / TLN2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Talin 2 (Antibody to) / talin 2
Alternative technique: antibodies
Alternative to gene target: Cell surfaces, TLN2 and IDBG-15260 and ENSG00000171914 and 83660, TLN2 and IDBG-646546 and ENSBTAG00000003667 and 528252, Tln2 and IDBG-180368 and ENSMUSG00000052698 and 70549, actin filament binding, this GO :0001726 and ruffle and cellular component this GO :0003779 and actin binding and molecular function this GO :0005158 and insulin receptor binding and molecular function this GO :0005198 and structural molecule activity and molecular function this GO :0005200 and structural constituent of cytoskeleton and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0005916 and fascia adherens and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0007016 and cytoskeletal anchoring at plasma membrane and biological process this GO :0007043 and cell-cell junction assembly and biological process this GO :0007155 and cell adhesion and biological process this GO :0015629 and actin cytoskeleton and cellular component this GO :0045202 and synapse and cellular component this GO :0051015 and actin filament binding and molecular function, this GO :0003779 : actin binding, this GO :0003779 : actin binding and also this GO :0005158 : insulin receptor binding and also this GO :0005198 : structural molecule activity and also this GO :0005200 : structural constituent of cytoskeleton and also this GO :0005515 : protein binding and also this GO :0051015 : actin filament binding, this GO :0005158 : insulin receptor binding, this GO :0005198 : structural molecule activity, this GO :0005200 : structural constituent of cytoskeleton, this GO :0005515 : protein binding, this GO :0051015 : actin filament binding, talin 2
Identity: 15447
Gene: TLN2 | More about : TLN2
Long gene name: talin 2
Synonyms: KIAA0320 ILWEQ
Locus: 15q22, 2
Discovery year: 2001-04-25
GenBank acession: AB002318
Entrez gene record: 83660
Pubmed identfication: 9205841 11527381
Classification: FERM domain containing
Havana BLAST/BLAT: OTTHUMG00000133679

Related Products :

R32413 Talin 2 Antibody / TLN2 0.1mg 406 € NJS poly human
abx572826 Anti-Human Talin 2 (TLN2) ELISA Kit inquire 50 € abbex human
DL-TLN2-Hu Human Talin 2 TLN2 ELISA Kit 96T 904 € DL elisas human
EKU07567 Talin 2 (TLN2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
XW-7621 anti-TLN2 Antibody 0.05 mg 180 € proscience human
abx219003 Anti-TLN2 Antibody 200 μg 369 € abbex human
abx936883 Anti-TLN2 siRNA inquire 50 € abbex human
abx936884 Anti-TLN2 siRNA inquire 50 € abbex human
GWB-BBB084 Monoclonal antibody to or anti-Talin antibody antibody 1 vial 434 € genways human
AM20670PU-N anti-Talin-1 (TLN1) Antibody 0,1 mg 543 € acr human
AM20950PU-N anti-Talin-1 (TLN1) Antibody 50 Вµg 819 € acr human
AM20951PU-N anti-Talin-1 (TLN1) Antibody 50 Вµg 819 € acr human
AM20952PU-N anti-Talin-1 (TLN1) Antibody 50 Вµg 819 € acr human
BB-MA1092 anti-Talin-1 (TLN1) Antibody 0,1 mg 471 € acr human
CPA4532-100ul anti-Talin-1 (TLN1) Antibody 0,1 ml 442 € acr human
CPA4532-200ul anti-Talin-1 (TLN1) Antibody 0,2 ml 688 € acr human
CPA4532-30ul anti-Talin-1 (TLN1) Antibody 30 Вµl 326 € acr human
abx128681 Anti-Talin Antibody 50 μg 383 € abbex human
abx129513 Anti-Talin Antibody 100 μg 499 € abbex human
abx130239 Anti-Talin Antibody 50 μg 412 € abbex human
GENTAUR-58bdc249bfd3b Anti- Talin (TLN) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdc9ce81753 Anti- Talin (TLN) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdc9cecb74d Anti- Talin (TLN) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdda4e78e9a Anti- Talin (TLN) Antibody 100ug 520 € MBS Polyclonals human
MBS422021 Goat anti-Talin 1 / TLN1 Antibody 100ug 370 € MBS Polyclonals_1 human
GENTAUR-58bde4c1cbf4d MOUSE Anti-HUMAN TALIN-1 Antibody 200ug 503 € MBS mono human
GENTAUR-58bde4c224d49 MOUSE Anti-HUMAN TALIN-1 Antibody 100ug 393 € MBS mono human
GENTAUR-58bde4c2546b6 MOUSE Anti-HUMAN TALIN-2 Antibody 200ug 503 € MBS mono human
GENTAUR-58bde4c2d7bcd MOUSE Anti-HUMAN TALIN-2 Antibody 100ug 393 € MBS mono human
GENTAUR-58bde44caa9be MOUSE Anti-HUMAN TALIN Antibody 200ug 608 € MBS mono human