| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
IL7R / CD127 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Intented use: |
This IL7R antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P16871 |
| Purity: |
Antigen affinity |
| Description: |
Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID), Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination, It is mapped to 5p13, Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes, This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, also known as IL7R alpha, by STAT5 and histone acetylation, is a protein found on the surface of cells, The interleukin-7 receptor |
| Immunogen: |
Amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha were used as the immunogen for the IL7R antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IL7R antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
IL7R / CD127 |
| Short name: |
IL7R Antibody / CD127 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
interleukin 7 receptor (Antibody to) / CD127 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, Extracellular, IL7R and IDBG-16161 and ENSG00000168685 and 3575, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, protein binding, this GO :0000018 and regulation of DNA recombination and biological process this GO :0000902 and cell morphogenesis and biological process this GO :0001915 and negative regulation of T cell mediated cytotoxicity and biological process this GO :0002377 and immunoglobulin production and biological process this GO :0003823 and antigen binding and molecular function this GO :0004896 and cytokine receptor activity and molecular function this GO :0004917 and interleukin-7 receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008361 and regulation of cell size and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016049 and cell growth and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030217 and T cell differentiation and biological process this GO :0033089 and positive regulation of T cell differentiation in thymus and biological process this GO :0038111 and interleukin-7-mediated signaling pathway and biological process this GO :0042100 and B cell proliferation and biological process this GO :0048535 and lymph node development and biological process this GO :0048872 and homeostasis of number of cells and biological process, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004896 : cytokine receptor activity and also this GO :0004917 : interleukin-7 receptor activity and also this GO :0005515 : protein binding, this GO :0004896 : cytokine receptor activity, this GO :0004917 : interleukin-7 receptor activity, this GO :0005515 : protein binding, interleukin 7 receptor |
| Identity: |
6024 |
| Gene: |
IL7R |
More about : IL7R |
| Long gene name: |
interleukin 7 receptor |
| Synonyms: |
CD127 |
| Locus: |
5p13, 2 |
| Discovery year: |
1991-08-07 |
| GenBank acession: |
M29696 |
| Entrez gene record: |
3575 |
| Pubmed identfication: |
2317865 |
| Classification: |
CD molecules Fibronectin type III domain containing Interleukin receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000090791 |
| Locus Specific Databases: |
IL7Rbase: Mutation registry for Interleukin-7 receptor &, deficiency LRG_74 , #945 |