IL7R Antibody / CD127

Contact us
Catalog number: R32384
Price: 406 €
Supplier: NJS poly
Product name: IL7R Antibody / CD127
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: IL7R / CD127
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Intented use: This IL7R antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P16871
Purity: Antigen affinity
Description: Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID), Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination, It is mapped to 5p13, Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes, This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, also known as IL7R alpha, by STAT5 and histone acetylation, is a protein found on the surface of cells, The interleukin-7 receptor
Immunogen: Amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha were used as the immunogen for the IL7R antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IL7R antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: IL7R / CD127
Short name: IL7R Antibody / CD127
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: interleukin 7 receptor (Antibody to) / CD127
Alternative technique: antibodies
Alternative to gene target: CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, Extracellular, IL7R and IDBG-16161 and ENSG00000168685 and 3575, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, protein binding, this GO :0000018 and regulation of DNA recombination and biological process this GO :0000902 and cell morphogenesis and biological process this GO :0001915 and negative regulation of T cell mediated cytotoxicity and biological process this GO :0002377 and immunoglobulin production and biological process this GO :0003823 and antigen binding and molecular function this GO :0004896 and cytokine receptor activity and molecular function this GO :0004917 and interleukin-7 receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008361 and regulation of cell size and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016049 and cell growth and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030217 and T cell differentiation and biological process this GO :0033089 and positive regulation of T cell differentiation in thymus and biological process this GO :0038111 and interleukin-7-mediated signaling pathway and biological process this GO :0042100 and B cell proliferation and biological process this GO :0048535 and lymph node development and biological process this GO :0048872 and homeostasis of number of cells and biological process, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004896 : cytokine receptor activity and also this GO :0004917 : interleukin-7 receptor activity and also this GO :0005515 : protein binding, this GO :0004896 : cytokine receptor activity, this GO :0004917 : interleukin-7 receptor activity, this GO :0005515 : protein binding, interleukin 7 receptor
Identity: 6024
Gene: IL7R | More about : IL7R
Long gene name: interleukin 7 receptor
Synonyms: CD127
Locus: 5p13, 2
Discovery year: 1991-08-07
GenBank acession: M29696
Entrez gene record: 3575
Pubmed identfication: 2317865
Classification: CD molecules Fibronectin type III domain containing Interleukin receptors
Havana BLAST/BLAT: OTTHUMG00000090791
Locus Specific Databases: IL7Rbase: Mutation registry for Interleukin-7 receptor &, deficiency LRG_74 , #945

Related Products :