| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
AMPK beta 1 / PRKAB1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the PRKAB1 antibody should be determined by the researcher |
| Intented use: |
This PRKAB1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9Y478 |
| Purity: |
Antigen affinity |
| Description: |
AMPK is a heterotrimer consisting of an alpha catalytic subunit, AMPK is activated, In response to cellular metabolic stresses, It is an important energy-sensing enzyme that monitors cellular energy status, The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK, The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK), This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex, This subunit may be a positive regulator of AMPK activity, and non-catalytic beta and gamma subunits, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol, 5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene |
| Immunogen: |
Amino acids DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE of human AMPK beta 1 were used as the immunogen for the PRKAB1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PRKAB1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
AMPK beta 1 / PRKAB1 |
| Short name: |
AMPK beta 1 Antibody / PRKAB1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
AMP-activated, b 1 non-catalytic subunit, AMPK b 1 (Antibody to) / protein phosphorylation catalyst |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
AMP-activated, AMPK and HAMPKb, PRKAB1 and IDBG-59969 and ENSG00000111725 and 5564, PRKAB1 and IDBG-633372 and ENSBTAG00000005940 and 534107, Prkab1 and IDBG-194478 and ENSMUSG00000029513 and 19079, beta 1 non-catalytic subunit, nuclei, protein kinase binding, this GO :0004672 and protein kinase activity and molecular function this GO :0004679 and AMP-activated protein kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005829 and cytosol and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006633 and fatty acid biosynthetic process and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0031588 and AMP-activated protein kinase complex and cellular component this GO :0043234 and protein complex and cellular component this GO :0050790 and regulation of catalytic activity and biological process this GO :0051291 and protein heterooli this GO merization and biological process this GO :0061024 and membrane organization and biological process, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004679 : AMP-activated protein kinase activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding, this GO :0004679 : AMP-activated protein kinase activity, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, protein kinase |
| Identity: |
9378 |
| Gene: |
PRKAB1 |
More about : PRKAB1 |
| Long gene name: |
protein kinase AMP-activated non-catalytic subunit beta 1 |
| Synonyms gene name: |
AMP-activated, beta 1 non-catalytic subunit , protein kinase |
| Synonyms name: |
AMPK beta 1 |
| Locus: |
12q24, 23 |
| Discovery year: |
1997-05-09 |
| GenBank acession: |
BC001823 |
| Entrez gene record: |
5564 |
| Pubmed identfication: |
8557660 |
| RefSeq identity: |
NM_006253 |
| Havana BLAST/BLAT: |
OTTHUMG00000168954 |