AMPK beta 1 Antibody / PRKAB1

Contact us
Catalog number: R32363
Price: 717 €
Supplier: abbex
Product name: AMPK beta 1 Antibody / PRKAB1
Quantity: 30 nmol
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AMPK beta 1 / PRKAB1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the PRKAB1 antibody should be determined by the researcher
Intented use: This PRKAB1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9Y478
Purity: Antigen affinity
Description: AMPK is a heterotrimer consisting of an alpha catalytic subunit, AMPK is activated, In response to cellular metabolic stresses, It is an important energy-sensing enzyme that monitors cellular energy status, The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK, The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK), This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex, This subunit may be a positive regulator of AMPK activity, and non-catalytic beta and gamma subunits, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol, 5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene
Immunogen: Amino acids DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE of human AMPK beta 1 were used as the immunogen for the PRKAB1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PRKAB1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AMPK beta 1 / PRKAB1
Short name: AMPK beta 1 Antibody / PRKAB1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: AMP-activated, b 1 non-catalytic subunit, AMPK b 1 (Antibody to) / protein phosphorylation catalyst
Alternative technique: antibodies
Alternative to gene target: AMP-activated, AMPK and HAMPKb, PRKAB1 and IDBG-59969 and ENSG00000111725 and 5564, PRKAB1 and IDBG-633372 and ENSBTAG00000005940 and 534107, Prkab1 and IDBG-194478 and ENSMUSG00000029513 and 19079, beta 1 non-catalytic subunit, nuclei, protein kinase binding, this GO :0004672 and protein kinase activity and molecular function this GO :0004679 and AMP-activated protein kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005829 and cytosol and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006633 and fatty acid biosynthetic process and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0031588 and AMP-activated protein kinase complex and cellular component this GO :0043234 and protein complex and cellular component this GO :0050790 and regulation of catalytic activity and biological process this GO :0051291 and protein heterooli this GO merization and biological process this GO :0061024 and membrane organization and biological process, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004679 : AMP-activated protein kinase activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding, this GO :0004679 : AMP-activated protein kinase activity, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, protein kinase
Identity: 9378
Gene: PRKAB1 | More about : PRKAB1
Long gene name: protein kinase AMP-activated non-catalytic subunit beta 1
Synonyms gene name: AMP-activated, beta 1 non-catalytic subunit , protein kinase
Synonyms name: AMPK beta 1
Locus: 12q24, 23
Discovery year: 1997-05-09
GenBank acession: BC001823
Entrez gene record: 5564
Pubmed identfication: 8557660
RefSeq identity: NM_006253
Havana BLAST/BLAT: OTTHUMG00000168954

Related Products :

MBS624349 AMPK beta, NT (5'-AMP-activated Protein Kinase Subunit beta-1, AMPK Subunit beta-1, AMPK, PRKAB1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS622597 AMP Activated Protein Kinase gamma1 (AMPK gamma-1 Chain, AMPK Subunit gamma-1, AMPK gamma1, AMPK g1, AMPKg, 5'-AMP-activated Protein Kinase Subunit gamma-1, MGC8666, PRKAG1) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS622720 AMP Activated Protein Kinase beta1 (AMPK beta-1 Chain, AMPK Subunit beta-1, AMPK b1, AMPKb, 5'-AMP-activated Protein Kinase Subunit beta-1, HAMPKb, MGC17785, PRKAB1) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS620772 AMP Activated Protein Kinase alpha1 (AMPK Subunit alpha-1, AMPK a1, AMPKa1, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-1, AMPK1, AMPK, MGC33776, MGC57364, PRKAA1) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS619057 AMP Activated Protein Kinase alpha2 (5'-AMP-activated Protein Kinase Catalytic Subunit alpha-2, AMPK alpha-2 Chain, AMPK Subunit alpha-2, AMPK a2, AMPK2, PRKAA2, PRKAA) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS622473 AMP Activated Protein Kinase alpha2 (AMPK alpha-2 Chain, AMPK Subunit alpha-2, AMPK a2, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-2, AMPK2, PRKAA2, PRKAA) Antibody 100ug 647 € MBS Polyclonals_1 human
F50060-0.08ML AMPK beta 1 Antibody (PRKAB1) 0.08 ml 199 € NJS poly human
F50060-0.4ML AMPK beta 1 Antibody (PRKAB1) 0.4 ml 406 € NJS poly human
R32363 AMPK beta 1 Antibody / PRKAB1 0.1mg 406 € NJS poly human
MBS247062 Anti-Human PRKAB1 / AMPK Beta 1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS247761 PAb (IgG) to Human PRKAB1 / AMPK Beta 1 50ug 597 € MBS Polyclonals_1 human
MBS624111 AMPK beta2, NT (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, PRKAB2) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS617100 AMP Activated Protein Kinase alpha1, phosphorylated (Ser485)/AMPKa2 (Ser491) (AMPK a1, AMPK a2) Antibody 100ul 603 € MBS Polyclonals_1 human
DL-PRKAb1-Hu Human Protein Kinase, AMP Activated Beta 1 PRKAb1 ELISA Kit 96T 869 € DL elisas human
EKU06930 Protein Kinase, AMP Activated Beta 1 (PRKAb1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU06931 Protein Kinase, AMP Activated Beta 1 (PRKAb1) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
DL-PRKAb1-Ra Rat Protein Kinase, AMP Activated Beta 1 PRKAb1 ELISA Kit 96T 962 € DL elisas rat
A03P0272 anti-PRKAB1 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdf1eebb359 Anti- PRKAB1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf1ef29785 Anti- PRKAB1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be45768356c Anti- PRKAB1 Antibody 100ug 393 € MBS Polyclonals human
abx136109 Anti-PRKAB1 Antibody 50 µl 354 € abbex human
GWB-ASE157 Human PRKAB1 Antibody bulk Ask price € genways bulk human
GWB-MU470B PRKAB1 antibody 1 vial 521 € genways human
MBS128574 PRKAB1 Polyclonal Antibody 200ug 663 € MBS Polyclonals_1 human
abx152823 Anti-Human PRKAb1 ELISA Kit inquire 50 € abbex human
abx572166 Anti-Human PRKAb1 ELISA Kit inquire 50 € abbex human
abx904231 Anti-PRKAB1 siRNA 30 nmol 717 € abbex human
abx929736 Anti-PRKAB1 siRNA 15 nmol 528 € abbex human
abx929737 Anti-PRKAB1 siRNA 30 nmol 717 € abbex human