SMC3 Antibody

Contact us
Catalog number: R32356
Price: 50 €
Supplier: abbex
Product name: SMC3 Antibody
Quantity: inquire
Other quantities: 0.1ml 263€ 1 tube 568€ 1 vial 521€ 100ug 525€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SMC3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SMC3 antibody should be determined by the researcher
Intented use: This SMC3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9UQE7
Purity: Antigen affinity
Description: Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, The encoded protein occurs in certain cell types as either an intracellular, The nuclear form, an abundant basement membrane protein, enabling proper chromosome segregation, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, known as structural maintenance of chromosomes 3, nuclear protein or a secreted protein, Structural maintenance of chromosomes 3 belongs to the SMC3 subfamily of SMC proteins
Immunogen: Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH of human SMC3 were used as the immunogen for the SMC3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SMC3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SMC3
Short name: SMC3 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SMC3 (Antibody to)
Alternative technique: antibodies
Identity: 2468
Gene: SMC3 | More about : SMC3
Long gene name: structural maintenance of chromosomes 3
Synonyms gene: CSPG6
Synonyms gene name: chondroitin sulfate proteoglycan 6 (bamacan)
Synonyms: HCAP BAM SMC3L1 bamacan
Synonyms name: bamacan proteoglycan
Locus: 10q25, 2
Discovery year: 1999-08-20
GenBank acession: AF020043
Entrez gene record: 9126
Pubmed identfication: 9506951 10358101 17273969
RefSeq identity: NM_005445
Classification: Proteoglycans Structural maintenance of chromosomes proteins Cohesin complex
Havana BLAST/BLAT: OTTHUMG00000019042
Locus Specific Databases: LOVD - Leiden Open Variation Database LRG_774

Related Products :

GENTAUR-58be43c550c9f Anti- SMC3 Antibody 100ug 393 € MBS Polyclonals human
abx218673 Anti-SMC3 Antibody inquire 50 € abbex human
GENTAUR-58bdd84d197e6 Anti- Structural Maintenance Of Chromosomes Protein 3 (SMC3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdda03e3e23 Anti- Structural Maintenance Of Chromosomes Protein 3 (SMC3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdda0457d01 Anti- Structural Maintenance Of Chromosomes Protein 3 (SMC3) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdda93994ea Anti- Structural Maintenance Of Chromosomes Protein 3 (SMC3) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58be3660ba6ed SMC3 antibody 100ug 525 € MBS mono human
GWB-60CC1E SMC3 antibody 1 tube 568 € genways human
GWB-MQ840C SMC3 antibody 1 vial 521 € genways human
GWB-MQ841D SMC3 antibody 1 vial 521 € genways human
R32356 SMC3 Antibody 0.1mg 406 € NJS poly human
bs-5735R-A350 SMC3 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5735R-A488 SMC3 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5735R-A555 SMC3 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5735R-A594 SMC3 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5735R-A647 SMC3 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-5735R-Biotin SMC3 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-5735R SMC3 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
MBS275714 SMC3 antibody [C2C3], C-term 100ul 426 € MBS Polyclonals_1 human
bs-5735R-Cy3 SMC3 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5735R-Cy5 SMC3 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5735R-Cy5.5 SMC3 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5735R-Cy7 SMC3 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-5735R-FITC SMC3 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-5735R-HRP SMC3 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS271432 SMC3 antibody [N1N2], N-term 100ul 426 € MBS Polyclonals_1 human
MBS126452 SMC3 Polyclonal Antibody 200ug 663 € MBS Polyclonals_1 human
GENTAUR-58be63d53568d Anti-SMC3 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx934338 Anti-SMC3 siRNA inquire 50 € abbex human
abx934339 Anti-SMC3 siRNA inquire 50 € abbex human