| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SMC3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SMC3 antibody should be determined by the researcher |
| Intented use: |
This SMC3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9UQE7 |
| Purity: |
Antigen affinity |
| Description: |
Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, The encoded protein occurs in certain cell types as either an intracellular, The nuclear form, an abundant basement membrane protein, enabling proper chromosome segregation, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, known as structural maintenance of chromosomes 3, nuclear protein or a secreted protein, Structural maintenance of chromosomes 3 belongs to the SMC3 subfamily of SMC proteins |
| Immunogen: |
Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH of human SMC3 were used as the immunogen for the SMC3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SMC3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SMC3 |
| Short name: |
SMC3 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SMC3 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
2468 |
| Gene: |
SMC3 |
More about : SMC3 |
| Long gene name: |
structural maintenance of chromosomes 3 |
| Synonyms gene: |
CSPG6 |
| Synonyms gene name: |
chondroitin sulfate proteoglycan 6 (bamacan) |
| Synonyms: |
HCAP BAM SMC3L1 bamacan |
| Synonyms name: |
bamacan proteoglycan |
| Locus: |
10q25, 2 |
| Discovery year: |
1999-08-20 |
| GenBank acession: |
AF020043 |
| Entrez gene record: |
9126 |
| Pubmed identfication: |
9506951 10358101 17273969 |
| RefSeq identity: |
NM_005445 |
| Classification: |
Proteoglycans Structural maintenance of chromosomes proteins Cohesin complex |
| Havana BLAST/BLAT: |
OTTHUMG00000019042 |
| Locus Specific Databases: |
LOVD - Leiden Open Variation Database LRG_774 |