ING1 Antibody

Contact us
Catalog number: R32348
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: ING1 Antibody
Quantity: 100ul
Other quantities: 1 vial 521€ 200ug 663€ 50ug 365€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ING1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the ING1 antibody should be determined by the researcher
Intented use: This ING1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9UK53
Purity: Antigen affinity
Description: It is mapped to 13q34, Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported, Reduced expression and rearrangement of this gene have been detected in various cancers, The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway, This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis, Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene
Immunogen: Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ING1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ING1
Short name: ING1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ING1 (Antibody to)
Alternative technique: antibodies
Identity: 6062
Gene: ING1 | More about : ING1
Long gene name: inhibitor of growth family member 1
Synonyms: p33ING1 p33ING1b p24ING1c p33 p47 p47ING1a
Synonyms name: inhibitor of growth 1 tumor suppressor ING1 growth inhibitor ING1 growth inhibitory protein ING1
Locus: 13q34
Discovery year: 1996-10-26
Entrez gene record: 3621
Pubmed identfication: 8944021 9186514
RefSeq identity: NM_005537
Classification: PHD finger proteins
Havana BLAST/BLAT: OTTHUMG00000017346

Related Products :

GWB-46E6CA antibody to or anti-p33 ING1 antibody 1 x 1 vial 667 € genways human
GWB-314504 Inhibitor Of Growth 1 Family Member 1 (ING1) Goat antibody to or anti-Human Polyclonal (aa285-296) antibody 1 x 1 vial 648 € genways human
AR51711PU-N anti-ING1 (1-279, His-tag) Antibody 0,5 mg 1109 € acr human
AR51711PU-S anti-ING1 (1-279, His-tag) Antibody 0,1 mg 485 € acr human
AP07596PU-N anti-ING1 Antibody 50 Вµg 732 € acr human
GENTAUR-58be0b7556247 Anti- ING1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0b75b869e Anti- ING1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0d16afa30 Anti- ING1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0d171ec68 Anti- ING1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0e08ee5fb Anti- ING1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0e09b37ab Anti- ING1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be45c678dd7 Anti- ING1 Antibody 100ug 393 € MBS Polyclonals human
abx146511 Anti-ING1 Antibody 200 μg 369 € abbex human
abx147020 Anti-ING1 Antibody 100 μg 311 € abbex human
abx225248 Anti-ING1 Antibody 100 μl 383 € abbex human
R1608CP anti-ING1 Control Peptide Antibody 50 Вµg 340 € acr human
GENTAUR-58bdf605e981d Anti- ING1-specific Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf60661601 Anti- ING1-specific Antibody 0.06 ml 265 € MBS Polyclonals human
MBS240556 Goat Polyclonal to Human ING1 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-MR932E ING1 antibody 1 vial 521 € genways human
GWB-MR933F ING1 antibody 1 vial 440 € genways human
MBS126271 ING1 Antibody 50ug 365 € MBS Polyclonals_1 human
R32348 ING1 Antibody 0.1mg 406 € NJS poly human
MBS620169 ING1, p33 (Inhibitor of Growth 1) Antibody 0.4 ml 619 € MBS Polyclonals_1 human
MBS622617 ING1, p33 (Inhibitor of Growth 1) Antibody 100ug 586 € MBS Polyclonals_1 human
bs-1291R-A350 ING1/p33ING1b Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1291R-A488 ING1/p33ING1b Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1291R-A555 ING1/p33ING1b Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1291R-A594 ING1/p33ING1b Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1291R-A647 ING1/p33ING1b Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human