| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ING1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the ING1 antibody should be determined by the researcher |
| Intented use: |
This ING1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9UK53 |
| Purity: |
Antigen affinity |
| Description: |
It is mapped to 13q34, Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported, Reduced expression and rearrangement of this gene have been detected in various cancers, The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway, This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis, Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene |
| Immunogen: |
Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ING1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ING1 |
| Short name: |
ING1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
ING1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
6062 |
| Gene: |
ING1 |
More about : ING1 |
| Long gene name: |
inhibitor of growth family member 1 |
| Synonyms: |
p33ING1 p33ING1b p24ING1c p33 p47 p47ING1a |
| Synonyms name: |
inhibitor of growth 1 tumor suppressor ING1 growth inhibitor ING1 growth inhibitory protein ING1 |
| Locus: |
13q34 |
| Discovery year: |
1996-10-26 |
| Entrez gene record: |
3621 |
| Pubmed identfication: |
8944021 9186514 |
| RefSeq identity: |
NM_005537 |
| Classification: |
PHD finger proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000017346 |