Parvin alpha Antibody / PARVA

Contact us
Catalog number: R32338
Price: 406 €
Supplier: NJS poly
Product name: Parvin alpha Antibody / PARVA
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Parvin alpha / PARVA
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PARVA antibody should be determined by the researcher
Intented use: This PARVA antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9NVD7
Purity: Antigen affinity
Description: It is located on 11p15, PARVA belongs to the parvin family of actin-binding proteins, Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments, The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival, 3, Parvin alpha is a protein that in humans is encoded by the PARVA gene
Immunogen: Amino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PARVA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Parvin alpha / PARVA
Short name: Parvin alpha Antibody / PARVA
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: a, Parvin a (Antibody to) / parvin
Alternative technique: antibodies
Alternative to gene target: PARVA and IDBG-32473 and ENSG00000197702 and 55742, PARVA and IDBG-632993 and ENSBTAG00000000700 and 615430, Parva and IDBG-206984 and ENSMUSG00000030770 and 57342, alpha, nuclei, protein binding, this GO :0002040 and sprouting angiogenesis and biological process this GO :0003148 and outflow tract septum morphogenesis and biological process this GO :0003779 and actin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007163 and establishment or maintenance of cell polarity and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0015629 and actin cytoskeleton and cellular component this GO :0030018 and Z disc and cellular component this GO :0030027 and lamellipodium and cellular component this GO :0031532 and actin cytoskeleton reorganization and biological process this GO :0034113 and heterotypic cell-cell adhesion and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034446 and substrate adhesion-dependent cell spreading and biological process this GO :0060271 and cilium morphogenesis and biological process this GO :0070252 and actin-mediated cell contraction and biological process this GO :0071670 and smooth muscle cell chemotaxis and biological process, this GO :0003779 : actin binding, this GO :0003779 : actin binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, parvin
Identity: 14652
Gene: PARVA | More about : PARVA
Long gene name: parvin alpha
Synonyms gene: MXRA2
Synonyms gene name: matrix-remodelling associated 2
Synonyms: FLJ12254 FLJ10793
Locus: 11p15, 3
Discovery year: 2001-04-26
GenBank acession: AF237771
Entrez gene record: 55742
Pubmed identfication: 11171322
RefSeq identity: NM_018222
Classification: Parvins
Havana BLAST/BLAT: OTTHUMG00000165778

Related Products :