| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Parvin alpha / PARVA |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PARVA antibody should be determined by the researcher |
| Intented use: |
This PARVA antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9NVD7 |
| Purity: |
Antigen affinity |
| Description: |
It is located on 11p15, PARVA belongs to the parvin family of actin-binding proteins, Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments, The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival, 3, Parvin alpha is a protein that in humans is encoded by the PARVA gene |
| Immunogen: |
Amino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PARVA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Parvin alpha / PARVA |
| Short name: |
Parvin alpha Antibody / PARVA |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
a, Parvin a (Antibody to) / parvin |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
PARVA and IDBG-32473 and ENSG00000197702 and 55742, PARVA and IDBG-632993 and ENSBTAG00000000700 and 615430, Parva and IDBG-206984 and ENSMUSG00000030770 and 57342, alpha, nuclei, protein binding, this GO :0002040 and sprouting angiogenesis and biological process this GO :0003148 and outflow tract septum morphogenesis and biological process this GO :0003779 and actin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007163 and establishment or maintenance of cell polarity and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0015629 and actin cytoskeleton and cellular component this GO :0030018 and Z disc and cellular component this GO :0030027 and lamellipodium and cellular component this GO :0031532 and actin cytoskeleton reorganization and biological process this GO :0034113 and heterotypic cell-cell adhesion and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034446 and substrate adhesion-dependent cell spreading and biological process this GO :0060271 and cilium morphogenesis and biological process this GO :0070252 and actin-mediated cell contraction and biological process this GO :0071670 and smooth muscle cell chemotaxis and biological process, this GO :0003779 : actin binding, this GO :0003779 : actin binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, parvin |
| Identity: |
14652 |
| Gene: |
PARVA |
More about : PARVA |
| Long gene name: |
parvin alpha |
| Synonyms gene: |
MXRA2 |
| Synonyms gene name: |
matrix-remodelling associated 2 |
| Synonyms: |
FLJ12254 FLJ10793 |
| Locus: |
11p15, 3 |
| Discovery year: |
2001-04-26 |
| GenBank acession: |
AF237771 |
| Entrez gene record: |
55742 |
| Pubmed identfication: |
11171322 |
| RefSeq identity: |
NM_018222 |
| Classification: |
Parvins |
| Havana BLAST/BLAT: |
OTTHUMG00000165778 |