TRPV5 Antibody

Contact us
Catalog number: R32330
Price: 1041 €
Supplier: genways
Product name: TRPV5 Antibody
Quantity: 1 vial
Other quantities: 0.08 ml 199€ 0.1mg 406€ 0.4 ml 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: TRPV5
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the TRPV5 antibody should be determined by the researcher
Intented use: This TRPV5 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9NQA5
Purity: Antigen affinity
Description: And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level, Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, In addition, TRPV5 is mainly expressed in kidney epithelial cells, The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, This gene is a member of the transient receptor family and the TrpV subfamily, an N-linked glycosylation site, and 5 ANK repeats, and bone loss, and consequential hyperparathyroidism, multiple potential phosphorylation sites, where it plays an important role in the reabsorption of Ca2+, Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene
Immunogen: Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TRPV5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: TRPV5
Short name: TRPV5 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: TRPV5 (Antibody to)
Alternative technique: antibodies
Identity: 3145
Gene: TRPV5 | More about : TRPV5
Long gene name: transient receptor potential cation channel subfamily V member 5
Synonyms gene: ECAC1
Synonyms gene name: epithelial calcium channel 1 transient receptor potential cation channel, member 5 , subfamily V
Synonyms: CaT2
Locus: 7q34
Discovery year: 2000-05-05
GenBank acession: AJ271207
Entrez gene record: 56302
Pubmed identfication: 10944439 10945469 16382100
RefSeq identity: NM_019841
Classification: Ankyrin repeat domain containing Transient receptor potential cation channels
Havana BLAST/BLAT: OTTHUMG00000157157

Related Products :

GENTAUR-58bdfc4d14ace Anti- TRPV5 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfc4d6492b Anti- TRPV5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be07442a227 Anti- TRPV5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0744a288c Anti- TRPV5 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3177c89b0 Anti- TRPV5 Antibody 0.2 ml 603 € MBS Polyclonals human
GENTAUR-58be4e922cc52 Anti- TRPV5 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be4e929cafd Anti- TRPV5 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be4e92f3597 Anti- TRPV5 Antibody 100ug 387 € MBS Polyclonals human
abx142280 Anti-TRPV5 Antibody 100 μl 383 € abbex human
AP54366PU-N anti-TRPV5 / ECAC1 (C-term) Antibody 0,4 ml 587 € acr human
MBS420745 Goat anti-TRPV5 Antibody 100ug 370 € MBS Polyclonals_1 human
F45042-0.08ML TRPV5 Antibody 0.08 ml 199 € NJS poly human
F45042-0.4ML TRPV5 Antibody 0.4 ml 406 € NJS poly human
GWB-MR512H TRPV5 antibody 1 vial 521 € genways human
R32330 TRPV5 Antibody 0.1mg 406 € NJS poly human
R35921-100UG TRPV5 Antibody 0.1mg 406 € NJS poly human
YSRTMCA5618Z TRPV5, Mouse Monoclonal antibody-; Clone: 6D6 0.1 mg Ask price € accurate-monoclonals mouse
GENTAUR-58be668921936 Anti-TRPV5 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx905817 Anti-TRPV5 siRNA inquire 50 € abbex human
abx938248 Anti-TRPV5 siRNA inquire 50 € abbex human
abx938249 Anti-TRPV5 siRNA inquire 50 € abbex human
LV346133 TRPV5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human
GWB-6B2DC9 antibody to or anti- Control Immune Serum goat antibody to or anti- peptide sequence Carrier antibody 1 tube 729 € genways human
GWB-BE9688 antibody to or anti- Estrone-6 antibody antibody 1 vial 1041 € genways human