| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
TRPV5 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the TRPV5 antibody should be determined by the researcher |
| Intented use: |
This TRPV5 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9NQA5 |
| Purity: |
Antigen affinity |
| Description: |
And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level, Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, In addition, TRPV5 is mainly expressed in kidney epithelial cells, The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, This gene is a member of the transient receptor family and the TrpV subfamily, an N-linked glycosylation site, and 5 ANK repeats, and bone loss, and consequential hyperparathyroidism, multiple potential phosphorylation sites, where it plays an important role in the reabsorption of Ca2+, Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene |
| Immunogen: |
Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TRPV5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
TRPV5 |
| Short name: |
TRPV5 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
TRPV5 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
3145 |
| Gene: |
TRPV5 |
More about : TRPV5 |
| Long gene name: |
transient receptor potential cation channel subfamily V member 5 |
| Synonyms gene: |
ECAC1 |
| Synonyms gene name: |
epithelial calcium channel 1 transient receptor potential cation channel, member 5 , subfamily V |
| Synonyms: |
CaT2 |
| Locus: |
7q34 |
| Discovery year: |
2000-05-05 |
| GenBank acession: |
AJ271207 |
| Entrez gene record: |
56302 |
| Pubmed identfication: |
10944439 10945469 16382100 |
| RefSeq identity: |
NM_019841 |
| Classification: |
Ankyrin repeat domain containing Transient receptor potential cation channels |
| Havana BLAST/BLAT: |
OTTHUMG00000157157 |