RAB18 Antibody

Contact us
Catalog number: R32328
Price: 322 €
Supplier: ABM lentivectors
Product name: RAB18 Antibody
Quantity: 1.0 µg DNA
Other quantities: 1 vial 521€ 100ul 304€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RAB18
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the RAB18 antibody should be determined by the researcher
Intented use: This RAB18antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9NP72
Purity: Antigen affinity
Description: Alternatively spliced transcript variants have been found for this gene, It is a ubiquitously expressed protein with particularly high expression in the brain, Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development, Mutations in this gene are associated with Warburg micro syndrome type 3, The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles, Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene
Immunogen: Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RAB18 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RAB18
Short name: RAB18 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: member RAS oncogene family (Antibody to), RAB18
Alternative technique: antibodies
Alternative to gene target: GDP binding, RAB18 and IDBG-638686 and ENSBTAG00000009871 and 511160, RAB18 and IDBG-64998 and ENSG00000099246 and 22931, RAB18LI1 and WARBM3, Rab18 and IDBG-128020 and ENSMUSG00000073639 and 19330, member RAS oncogene family, nuclei, this GO :0001654 and eye development and biological process this GO :0003924 and GTPase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006184 and GTP catabolic process and biological process this GO :0006886 and intracellular protein transport and biological process this GO :0006913 and nucleocytoplasmic transport and biological process this GO :0007165 and signal transduction and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007420 and brain development and biological process this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0019003 and GDP binding and molecular function this GO :0034389 and lipid particle organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003924 : GTPase activity, this GO :0003924 : GTPase activity and also this GO :0005515 : protein binding and also this GO :0005525 : GTP binding and also this GO :0019003 : GDP binding, this GO :0005515 : protein binding, this GO :0005525 : GTP binding, this GO :0019003 : GDP binding, RAB18
Identity: 14244
Gene: RAB18 | More about : RAB18
Long gene name: RAB18, member RAS oncogene family
Locus: 10p12, 1
Discovery year: 2000-12-12
GenBank acession: AJ277145
Entrez gene record: 22931
Pubmed identfication: 10648831
RefSeq identity: NM_021252
Classification: RAB, member RAS oncogene GTPases
Havana BLAST/BLAT: OTTHUMG00000017861

Related Products :

GENTAUR-58ba13cd258a7 Arabidopsis thaliana Dehydrin Rab18 (RAB18) 100ug 1591 € MBS Recombinant Proteins human
GENTAUR-58ba13cd950b7 Arabidopsis thaliana Dehydrin Rab18 (RAB18) 1000ug 1591 € MBS Recombinant Proteins human
GENTAUR-58ba13ce371f6 Arabidopsis thaliana Dehydrin Rab18 (RAB18) 100ug 2089 € MBS Recombinant Proteins human
GENTAUR-58ba13ced90bb Arabidopsis thaliana Dehydrin Rab18 (RAB18) 1000ug 2089 € MBS Recombinant Proteins human
AP55681PU-N anti-RAB18 (1-206) Antibody 50 Вµg 732 € acr human
AR50114PU-N anti-RAB18 (1-206, His-tag) Antibody 0,25 mg 1413 € acr human
AR50114PU-S anti-RAB18 (1-206, His-tag) Antibody 50 Вµg 587 € acr human
A03P0328 anti-RAB18 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
C18223-1 anti-RAB18 Antibody 50 Вµg 347 € acr human
C18223-2 anti-RAB18 Antibody 0,1 mg 500 € acr human
GENTAUR-58be0a5bc0542 Anti- RAB18 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0a5c195ad Anti- RAB18 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be116370810 Anti- RAB18 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be1163ea549 Anti- RAB18 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be45b5d6083 Anti- RAB18 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be45f3ca066 Anti- RAB18 Antibody 100ug 370 € MBS Polyclonals human
abx218194 Anti-RAB18 Antibody 100 μg 311 € abbex human
GWB-ASE926 Human RAB18 Antibody bulk Ask price € genways bulk human
bsm-51333M RAB18 (1573CT811.119.39) Monoclonal Antibody 0.1ml 281 € Bioss Primary Unconjugated Antibodies human
GWB-ML503H RAB18 antibody 1 vial 521 € genways human
MBS416335 RAB18 Antibody 100ul 304 € MBS Polyclonals_1 human
R32328 RAB18 Antibody 0.1mg 406 € NJS poly human
MBS127236 RAB18 Polyclonal Antibody 50ug 304 € MBS Polyclonals_1 human
MBS248968 Anti-Human RAB18 50ug 597 € MBS Polyclonals_1 human
abx262931 Anti-RAB18, Member RAS Oncogene Family Protein (Recombinant) 1 mg 6662 € abbex human
abx904413 Anti-RAB18 siRNA 15 nmol 528 € abbex human
abx930607 Anti-RAB18 siRNA inquire 50 € abbex human
abx930608 Anti-RAB18 siRNA 15 nmol 528 € abbex human
GWB-P0749H RAB18, 1-206 aa, Recombinant Protein bulk Ask price € genways bulk human
LV280027 RAB18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human