| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RAB18 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the RAB18 antibody should be determined by the researcher |
| Intented use: |
This RAB18antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9NP72 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants have been found for this gene, It is a ubiquitously expressed protein with particularly high expression in the brain, Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development, Mutations in this gene are associated with Warburg micro syndrome type 3, The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles, Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene |
| Immunogen: |
Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RAB18 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RAB18 |
| Short name: |
RAB18 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
member RAS oncogene family (Antibody to), RAB18 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
GDP binding, RAB18 and IDBG-638686 and ENSBTAG00000009871 and 511160, RAB18 and IDBG-64998 and ENSG00000099246 and 22931, RAB18LI1 and WARBM3, Rab18 and IDBG-128020 and ENSMUSG00000073639 and 19330, member RAS oncogene family, nuclei, this GO :0001654 and eye development and biological process this GO :0003924 and GTPase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006184 and GTP catabolic process and biological process this GO :0006886 and intracellular protein transport and biological process this GO :0006913 and nucleocytoplasmic transport and biological process this GO :0007165 and signal transduction and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007420 and brain development and biological process this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0019003 and GDP binding and molecular function this GO :0034389 and lipid particle organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003924 : GTPase activity, this GO :0003924 : GTPase activity and also this GO :0005515 : protein binding and also this GO :0005525 : GTP binding and also this GO :0019003 : GDP binding, this GO :0005515 : protein binding, this GO :0005525 : GTP binding, this GO :0019003 : GDP binding, RAB18 |
| Identity: |
14244 |
| Gene: |
RAB18 |
More about : RAB18 |
| Long gene name: |
RAB18, member RAS oncogene family |
| Locus: |
10p12, 1 |
| Discovery year: |
2000-12-12 |
| GenBank acession: |
AJ277145 |
| Entrez gene record: |
22931 |
| Pubmed identfication: |
10648831 |
| RefSeq identity: |
NM_021252 |
| Classification: |
RAB, member RAS oncogene GTPases |
| Havana BLAST/BLAT: |
OTTHUMG00000017861 |