UHRF2 Antibody / NIRF

Contact us
Catalog number: R32308
Price: 486 €
Supplier: genways
Product name: UHRF2 Antibody / NIRF
Quantity: 1 vial
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: UHRF2 / NIRF
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the UHRF2 antibody should be determined by the researcher
Intented use: This UHRF2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q96PU4
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants some of which are non-protein coding, The encoded protein contains an NIRF_N domain, The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), This gene encodes a nuclear protein which is involved in cell-cycle regulation, This protein may also have a role in intranuclear degradation of polyglutamine aggregates, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation, and together they may play a role in tumorigenesis, E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene
Immunogen: Amino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN of human NIRF/UHRF2 were used as the immunogen for the UHRF2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UHRF2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: minor nuclear, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: UHRF2 / NIRF
Short name: UHRF2 Antibody / NIRF
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: UHRF2 (Antibody to) / NIRF
Alternative technique: antibodies
Identity: 12557
Gene: UHRF2 | More about : UHRF2
Long gene name: ubiquitin like with PHD and ring finger domains 2
Synonyms gene name: E3 ubiquitin protein ligase , ubiquitin-like with PHD and ring finger domains 2
Synonyms: RNF107 NIRF URF2 MGC33463 TDRD23
Synonyms name: Np95-like ring finger protein
Locus: 9p24, 1
Discovery year: 2000-03-15
GenBank acession: AF274049
Entrez gene record: 115426
Pubmed identfication: 12176013
RefSeq identity: NM_152306
Classification: PHD finger proteins Ring finger proteins Tudor domain containing
Havana BLAST/BLAT: OTTHUMG00000019521

Related Products :

GENTAUR-58be20daebb15 Anti-UHRF2/NIRF Mouse Monoclonal Antibody 100ug 382 € MBS mono mouse
R32308 UHRF2 Antibody / NIRF 0.1mg 406 € NJS poly human
abx141681 Anti-NIRF Antibody 200 μl 499 € abbex human
bs-6389R-A350 NIRF Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6389R-A488 NIRF Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6389R-A555 NIRF Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6389R-A594 NIRF Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6389R-A647 NIRF Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6389R-Biotin NIRF Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6389R NIRF Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-6389R-Cy3 NIRF Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6389R-Cy5 NIRF Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6389R-Cy5.5 NIRF Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6389R-Cy7 NIRF Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6389R-FITC NIRF Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6389R-HRP NIRF Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58be6486c533b Anti-NIRF (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GENTAUR-58bdea39851ae Anti- UHRF2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdea39ef6ae Anti- UHRF2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdea991d831 Anti- UHRF2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdea99818d7 Anti- UHRF2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be055000294 Anti- UHRF2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be05505056d Anti- UHRF2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3f2dd1973 Anti- UHRF2 Antibody 100ug 393 € MBS Polyclonals human
abx217174 Anti-UHRF2 Antibody 100 μg 311 € abbex human
F46715-0.08ML UHRF2 Antibody 0.08 ml 199 € NJS poly human
F46715-0.4ML UHRF2 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be4a5d04809 UHRF2 Antibody 100ug 370 € MBS mono human
GENTAUR-58be4a5d68084 UHRF2 Antibody 50ug 299 € MBS mono human
GWB-EF5350 UHRF2 antibody 1 vial 486 € genways human