| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
APH1A |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the APH1A antibody should be determined by the researcher |
| Intented use: |
This APH1A antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q96BI3 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants, Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease, The gamma secretase complex contains this gene product, The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing, along with the presenilin, and presenilin enhancer-2 proteins, nicastrin, or the paralogous anterior pharynx defective 1 homolog B (APH1B), APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein |
| Immunogen: |
Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the APH1A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
APH1A |
| Short name: |
APH1A Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
elegans) (Antibody to), anterior pharynx defective 1 homolog A (C |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
APH1A and IDBG-102071 and ENSG00000117362 and 51107, APH1A and IDBG-633431 and ENSBTAG00000021482 and 539247, Aph1a and IDBG-174034 and ENSMUSG00000015750 and 226548, Plasma membranes, elegans), protein binding, this GO :0001656 and metanephros development and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006509 and membrane protein ectodomain proteolysis and biological process this GO :0007219 and Notch signaling pathway and biological process this GO :0007220 and Notch receptor processing and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016485 and protein processing and biological process this GO :0031293 and membrane protein intracellular domain proteolysis and biological process this GO :0032580 and this GO lgi cisterna membrane and cellular component this GO :0042987 and amyloid precursor protein catabolic process and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, anterior pharynx defective 1 homolog A (C |
| Identity: |
29509 |
| Gene: |
APH1A |
More about : APH1A |
| Long gene name: |
aph-1 homolog A, gamma-secretase subunit |
| Synonyms gene name: |
anterior pharynx defective 1 homolog A (C, elegans) APH1A gamma secretase subunit |
| Synonyms: |
APH-1A CGI-78 |
| Locus: |
1q21, 2 |
| Discovery year: |
2005-02-08 |
| GenBank acession: |
AF151835 |
| Entrez gene record: |
51107 |
| Pubmed identfication: |
10810093 12110170 |
| RefSeq identity: |
NM_016022 |
| Havana BLAST/BLAT: |
OTTHUMG00000012545 |