APH1A Antibody

Contact us
Catalog number: R32302
Price: 597 €
Supplier: MBS Polyclonals_1
Product name: APH1A Antibody
Quantity: 50ug
Other quantities: 0.1mg 406€ 0.1ml 263€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: APH1A
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the APH1A antibody should be determined by the researcher
Intented use: This APH1A antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q96BI3
Purity: Antigen affinity
Description: Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants, Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease, The gamma secretase complex contains this gene product, The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing, along with the presenilin, and presenilin enhancer-2 proteins, nicastrin, or the paralogous anterior pharynx defective 1 homolog B (APH1B), APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein
Immunogen: Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the APH1A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: APH1A
Short name: APH1A Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: elegans) (Antibody to), anterior pharynx defective 1 homolog A (C
Alternative technique: antibodies
Alternative to gene target: APH1A and IDBG-102071 and ENSG00000117362 and 51107, APH1A and IDBG-633431 and ENSBTAG00000021482 and 539247, Aph1a and IDBG-174034 and ENSMUSG00000015750 and 226548, Plasma membranes, elegans), protein binding, this GO :0001656 and metanephros development and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006509 and membrane protein ectodomain proteolysis and biological process this GO :0007219 and Notch signaling pathway and biological process this GO :0007220 and Notch receptor processing and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016485 and protein processing and biological process this GO :0031293 and membrane protein intracellular domain proteolysis and biological process this GO :0032580 and this GO lgi cisterna membrane and cellular component this GO :0042987 and amyloid precursor protein catabolic process and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, anterior pharynx defective 1 homolog A (C
Identity: 29509
Gene: APH1A | More about : APH1A
Long gene name: aph-1 homolog A, gamma-secretase subunit
Synonyms gene name: anterior pharynx defective 1 homolog A (C, elegans) APH1A gamma secretase subunit
Synonyms: APH-1A CGI-78
Locus: 1q21, 2
Discovery year: 2005-02-08
GenBank acession: AF151835
Entrez gene record: 51107
Pubmed identfication: 10810093 12110170
RefSeq identity: NM_016022
Havana BLAST/BLAT: OTTHUMG00000012545

Related Products :

GWB-1C6F48 Anterior Pharynx Defective 1 Homolog A (APH1A) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 x 1 vial 602 € genways human
GWB-86C9EE Anterior Pharynx Defective 1 Homolog A (APH1A) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 602 € genways human
AP07271PU-N anti-APH1A Antibody 50 Вµg 732 € acr human
AP07656PU-N anti-APH1A Antibody 50 Вµg 732 € acr human
GENTAUR-58bdf7b388a19 Anti- APH1A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf7b401b23 Anti- APH1A Antibody 0.06 ml 265 € MBS Polyclonals human
AP30066CP-N anti-APH1A Control Peptide Antibody 50 Вµg 282 € acr human
AP30067CP-N anti-APH1A Control Peptide Antibody 50 Вµg 282 € acr human
AP13314PU-N anti-APH1A (N-term) Antibody 0,4 ml 587 € acr human
R32302 APH1A Antibody 0.1mg 406 € NJS poly human
R34323-100UG APH1A Antibody 0.1mg 406 € NJS poly human
bs-4259R-A350 APH1a Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4259R-A488 APH1a Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4259R-A555 APH1a Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4259R-A594 APH1a Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4259R-A647 APH1a Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-4259R-Biotin APH1a Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-4259R APH1a Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-4259R-Cy3 APH1a Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4259R-Cy5 APH1a Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4259R-Cy5.5 APH1a Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4259R-Cy7 APH1a Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-4259R-FITC APH1a Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-4259R-HRP APH1a Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS420705 Goat anti-APH1A Antibody 100ug 370 € MBS Polyclonals_1 human
MBS243196 Goat Polyclonal to Human APH1A / APH-1 Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58be629821205 Anti-APH1a (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx907785 Anti-APH1A siRNA inquire 50 € abbex human
abx907786 Anti-APH1A siRNA inquire 50 € abbex human
MBS240490 Anti-Human APH1A / APH-1 50ug 597 € MBS Polyclonals_1 human