SFTPA1/2 Antibody

Contact us
Catalog number: R32279
Price: 667 €
Supplier: genways
Product name: SFTPA1/2 Antibody
Quantity: 1 tube
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SFTPA1/2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-F, IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5-1ug/ml, 5ug/ml, IHC (Frozen): 0, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SFTPA1/2 antibody should be determined by the researcher
Intented use: This SFTPA1/2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q8IWL1 / Q8IWL2
Purity: Antigen affinity
Description: Alternate splicing results in multiple transcript variants, Mutations in this gene and a highly similar gene located nearby, Mutations in this gene are associated with idiopathic pulmonary fibrosis, SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins, SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10, The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication, The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms, This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens, are associated with idiopathic pulmonary fibrosis, which affect the highly conserved carbohydrate recognition domain, SFTPA1/2 is also known as SP-A
Immunogen: Amino acids VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN of human SFTPA1/2 were used as the immunogen for the SFTPA1/2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SFTPA1/2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membranous, secreted, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SFTPA1/2
Short name: SFTPA1/2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SFTPA1/2 (Antibody to)
Alternative technique: antibodies
Identity: 10798
Gene: SFTPA1 | More about : SFTPA1
Long gene name: surfactant protein A1
Synonyms gene: SFTP1
Synonyms gene name: pulmonary-associated protein A1 , surfactant
Synonyms: SP-A SP-A1 COLEC4
Synonyms name: pulmonary-associated protein A1A , surfactant
Locus: 10q22, 3
Discovery year: 2001-06-22
GenBank acession: BC026229
Entrez gene record: 653509
RefSeq identity: NM_005411
Classification: Collectins C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000018565

Related Products :

BB-PA1347 anti-SFTPA1 Antibody 0,1 mg 471 € acr human
GENTAUR-58bdefa07370d Anti- SFTPA1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdefa0cb8ca Anti- SFTPA1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be064a1c717 Anti- SFTPA1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be064a9028b Anti- SFTPA1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0f6e8c8b7 Anti- SFTPA1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0f6f0b67b Anti- SFTPA1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3d1479616 Anti- SFTPA1 Antibody 100ug 393 € MBS Polyclonals human
abx218729 Anti-SFTPA1 Antibody 200 μg 369 € abbex human
MBS422802 Goat anti-SFTPA1 / SFTPA2 (aa102-115) Antibody 100ug 370 € MBS Polyclonals_1 human
MBS248902 Goat Polyclonal to Human SFTPA1 + SFTPA2 Antibody 50ug 597 € MBS Polyclonals_1 human
R32279 SFTPA1/2 Antibody 0.1mg 406 € NJS poly human
R30413 SFTPA1 Antibody 0.1mg 389 € NJS poly human
R34223-100UG SFTPA1 Antibody 0.1mg 406 € NJS poly human
MBS127820 SFTPA1 Polyclonal Antibody 100ug 387 € MBS Polyclonals_1 human
abx161221 Anti-SFTPA1 Blocking Peptide 5 mg 427 € abbex human
abx933127 Anti-SFTPA1 siRNA inquire 50 € abbex human
abx933128 Anti-SFTPA1 siRNA inquire 50 € abbex human
AE19843HO-48 ELISA test for Horse Pulmonary surfactant-associated protein A (SFTPA1) 1x plate of 48 wells 402 € abebio horse
AE19837SH-48 ELISA test for Sheep Pulmonary surfactant-associated protein A (SFTPA1) 1x plate of 48 wells 402 € abebio sheep
AE19843HO-96 Horse Pulmonary surfactant-associated protein A (SFTPA1) ELISA Kit 1x plate of 96 wells 671 € abebio horse
GENTAUR-58ba39e4f3a21 Rat Pulmonary surfactant-associated protein A (Sftpa1) 100ug 1685 € MBS Recombinant Proteins rat
GENTAUR-58ba39e58305c Rat Pulmonary surfactant-associated protein A (Sftpa1) 1000ug 1685 € MBS Recombinant Proteins rat
GENTAUR-58ba39e61f33e Rat Pulmonary surfactant-associated protein A (Sftpa1) 100ug 2199 € MBS Recombinant Proteins rat
GENTAUR-58ba39e6d3c30 Rat Pulmonary surfactant-associated protein A (Sftpa1) 1000ug 2199 € MBS Recombinant Proteins rat
AE19837SH Sheep Pulmonary surfactant-associated protein A (SFTPA1) ELISA Kit 96 wells plate 810 € ab-elisa elisas sheep
AE19837SH-96 Sheep Pulmonary surfactant-associated protein A (SFTPA1) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human