| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SFTPA1/2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-F, IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5-1ug/ml, 5ug/ml, IHC (Frozen): 0, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SFTPA1/2 antibody should be determined by the researcher |
| Intented use: |
This SFTPA1/2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q8IWL1 / Q8IWL2 |
| Purity: |
Antigen affinity |
| Description: |
Alternate splicing results in multiple transcript variants, Mutations in this gene and a highly similar gene located nearby, Mutations in this gene are associated with idiopathic pulmonary fibrosis, SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins, SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10, The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication, The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms, This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens, are associated with idiopathic pulmonary fibrosis, which affect the highly conserved carbohydrate recognition domain, SFTPA1/2 is also known as SP-A |
| Immunogen: |
Amino acids VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN of human SFTPA1/2 were used as the immunogen for the SFTPA1/2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SFTPA1/2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membranous, secreted, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SFTPA1/2 |
| Short name: |
SFTPA1/2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SFTPA1/2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
10798 |
| Gene: |
SFTPA1 |
More about : SFTPA1 |
| Long gene name: |
surfactant protein A1 |
| Synonyms gene: |
SFTP1 |
| Synonyms gene name: |
pulmonary-associated protein A1 , surfactant |
| Synonyms: |
SP-A SP-A1 COLEC4 |
| Synonyms name: |
pulmonary-associated protein A1A , surfactant |
| Locus: |
10q22, 3 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
BC026229 |
| Entrez gene record: |
653509 |
| RefSeq identity: |
NM_005411 |
| Classification: |
Collectins C-type lectin domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000018565 |