| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
TRIF / TICAM1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the TRIF antibody should be determined by the researcher |
| Intented use: |
This TRIF antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q80UF7 |
| Purity: |
Antigen affinity |
| Description: |
(2003) mapped the TICAM1 gene to chromosome 19p13, (2003) showed that TICAM1 interacts specifically with TLR3, AP1, By coimmunoprecipitation analysis, By genomic sequence analysis, Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, It mediates the rather delayed cascade of two TLR-associated signaling cascades, Oshiumi et al, Oshiumi et al, Small interfering (si)RNA blockage of TICAM1, TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2, also known as TRIF, but not with other TLRs, is an adapter in responding to activation of toll-like receptors (TLRs), just upstream of the TIR domain, or IRF3, reduced IFNB production in response to dsRNA, through NFKB, where the other one is dependent upon a MyD88 adapter, 3, TICAM1 (TIR domain containing adaptor molecule 1) |
| Immunogen: |
Amino acids QDTEARVSLESLKMNTVAQLVAHQWADMETTE of mouse TRIF were used as the immunogen for the TRIF antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TRIF antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
TRIF / TICAM1 |
| Short name: |
TRIF Antibody / TICAM1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
TRIF (Antibody to) / toll-like receptor adaptor molecule 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BT, Cytoplasm, TICAM1 and IDBG-19505 and ENSG00000127666 and 148022, Ticam1 and IDBG-191912 and ENSMUSG00000047123 and 106759, protein kinase binding, this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002281 and macrophage activation involved in immune response and biological process this GO :0002756 and MyD88-independent toll-like receptor signaling pathway and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007249 and I-kappaB kinase/NF-kappaB signaling and biological process this GO :0010008 and endosome membrane and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0031398 and positive regulation of protein ubiquitination and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032092 and positive regulation of protein binding and biological process this GO :0032481 and positive regulation of type I interferon production and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0032816 and positive regulation of natural killer cell activation and biological process this GO :0034138 and toll-like receptor 3 signaling pathway and biological process this GO :0034142 and toll-like receptor 4 signaling pathway and biological process this GO :0035666 and TRIF-dependent toll-like receptor signaling pathway and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043330 and response to exogenous dsRNA and biological process this GO :0043496 and regulation of protein homodimerization activity and biological process this GO :0045080 and positive regulation of chemokine biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045359 and positive regulation of interferon-beta biosynthetic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0050871 and positive regulation of B cell activation and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051607 and defense response to virus and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097342 and ripoptosome and cellular component, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, 47460 and IDBG-644220 and ENSBTAG00000019966 and 510427, toll-like receptor adaptor molecule 1 |
| Identity: |
18348 |
| Gene: |
TICAM1 |
More about : TICAM1 |
| Long gene name: |
toll like receptor adaptor molecule 1 |
| Synonyms gene name: |
toll-like receptor adaptor molecule 1 |
| Synonyms: |
TRIF TICAM-1 MGC35334 PRVTIRB |
| Synonyms name: |
TIR domain-containing adapter molecule 1 |
| Locus: |
19p13, 3 |
| Discovery year: |
2005-06-27 |
| GenBank acession: |
AB086380 |
| Entrez gene record: |
148022 |
| Pubmed identfication: |
12539043 12471095 |
| RefSeq identity: |
NM_014261 |
| Classification: |
TIR domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000180248 |
| Locus Specific Databases: |
LRG_358 |