CRY2 Antibody

Contact us
Catalog number: R32258
Price: 602 €
Supplier: genways
Product name: CRY2 Antibody
Quantity: 1 vial
Other quantities: 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: CRY2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the CRY2 antibody should be determined by the researcher
Intented use: This CRY2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q49AN0
Purity: Antigen affinity
Description: And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL, Polymorphisms in this gene have been associated with altered sleep patterns, The encoded protein is widely conserved across plants and animals, Two transcript variants encoding different isoforms have been found for this gene, which regulates the circadian clock, This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex
Immunogen: Amino acids RFQAIISRMELPKKPVGLVTSQQMESCRAE of human CRY2 were used as the immunogen for the CRY2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CRY2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: CRY2
Short name: CRY2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: CRY2 (Antibody to)
Alternative technique: antibodies
Identity: 2385
Gene: CRY2 | More about : CRY2
Long gene name: cryptochrome circadian clock 2
Synonyms gene name: cryptochrome 2 (photolyase-like)
Locus: 11p11, 2
Discovery year: 1997-03-21
GenBank acession: AB014558
Entrez gene record: 1408
Pubmed identfication: 8909283
RefSeq identity: NM_021117
Havana BLAST/BLAT: OTTHUMG00000153225

Related Products :

GWB-A497B0 Cryptochrome 2 (CRY2) Rabbit antibody to or anti-Human Polyclonal (aa579-593) antibody 1 vial 602 € genways human
GENTAUR-58bdef6051af6 Anti- CRY2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdef60a9b02 Anti- CRY2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be429ef3ac1 Anti- CRY2 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be53ce0169e Anti- CRY2 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be53ce619d0 Anti- CRY2 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be53cec7b3f Anti- CRY2 Antibody 50ug 304 € MBS Polyclonals human
MBS241016 Anti-Human CRY2 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-MS598D CRY2 antibody 1 vial 521 € genways human
R32258 CRY2 Antibody 0.1mg 406 € NJS poly human
MBS621969 Cryptochrome 2 (CRY2) Antibody 50ug 492 € MBS Polyclonals_1 human
MBS621975 Cryptochrome 2 (CRY2) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
abx912860 Anti-CRY2 siRNA 30 nmol 717 € abbex human
abx912861 Anti-CRY2 siRNA 30 nmol 717 € abbex human
LV127355 CRY2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV127356 CRY2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV127357 CRY2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV127358 CRY2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV127360 CRY2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV127359 CRY2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GWB-B062D4 CRY2 Over-expression Lysate reagent 1 vial 463 € genways human
CRY21-P Mouse Cryptochrome 2 (CRY2) Control/blocking peptide #1 100 μg 188 € adi mouse
CRY21-A Rabbit Anti-Mouse Cryptochrome 2 (CRY2) 100 μg 565 € adi mouse
CRY21-S Rabbit Anti-Mouse Cryptochrome 2 (CRY2) antiserum #1 100 μL 536 € adi mouse
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human