| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
CRY2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the CRY2 antibody should be determined by the researcher |
| Intented use: |
This CRY2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q49AN0 |
| Purity: |
Antigen affinity |
| Description: |
And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL, Polymorphisms in this gene have been associated with altered sleep patterns, The encoded protein is widely conserved across plants and animals, Two transcript variants encoding different isoforms have been found for this gene, which regulates the circadian clock, This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex |
| Immunogen: |
Amino acids RFQAIISRMELPKKPVGLVTSQQMESCRAE of human CRY2 were used as the immunogen for the CRY2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CRY2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
CRY2 |
| Short name: |
CRY2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
CRY2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
2385 |
| Gene: |
CRY2 |
More about : CRY2 |
| Long gene name: |
cryptochrome circadian clock 2 |
| Synonyms gene name: |
cryptochrome 2 (photolyase-like) |
| Locus: |
11p11, 2 |
| Discovery year: |
1997-03-21 |
| GenBank acession: |
AB014558 |
| Entrez gene record: |
1408 |
| Pubmed identfication: |
8909283 |
| RefSeq identity: |
NM_021117 |
| Havana BLAST/BLAT: |
OTTHUMG00000153225 |