| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HKDC1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the HKDC1 antibody should be determined by the researcher |
| Intented use: |
This HKDC1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q2TB90 |
| Purity: |
Antigen affinity |
| Description: |
HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate |
| Immunogen: |
Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HKDC1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HKDC1 |
| Short name: |
HKDC1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
HKDC1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
23302 |
| Gene: |
HKDC1 |
More about : HKDC1 |
| Long gene name: |
hexokinase domain containing 1 |
| Synonyms: |
FLJ37767 FLJ22761 |
| Locus: |
10q22, 1 |
| Discovery year: |
2004-05-27 |
| Entrez gene record: |
80201 |
| Pubmed identfication: |
12477932 |
| RefSeq identity: |
NM_025130 |
| Havana BLAST/BLAT: |
OTTHUMG00000018371 |