HKDC1 Antibody

Contact us
Catalog number: R32256
Price: 932 €
Supplier: genways
Product name: HKDC1 Antibody
Quantity: 1 x 1 vial
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HKDC1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the HKDC1 antibody should be determined by the researcher
Intented use: This HKDC1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q2TB90
Purity: Antigen affinity
Description: HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate
Immunogen: Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HKDC1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HKDC1
Short name: HKDC1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: HKDC1 (Antibody to)
Alternative technique: antibodies
Identity: 23302
Gene: HKDC1 | More about : HKDC1
Long gene name: hexokinase domain containing 1
Synonyms: FLJ37767 FLJ22761
Locus: 10q22, 1
Discovery year: 2004-05-27
Entrez gene record: 80201
Pubmed identfication: 12477932
RefSeq identity: NM_025130
Havana BLAST/BLAT: OTTHUMG00000018371

Related Products :

AE39919HU-48 ELISA test for Human Putative hexokinase HKDC1 (HKDC1) 1x plate of 48 wells 373 € abebio human
AE39919HU-96 Human Putative hexokinase HKDC1 (HKDC1) ELISA Kit 1x plate of 96 wells 612 € abebio human
R32256 HKDC1 Antibody 0.1mg 406 € NJS poly human
abx919550 Anti-HKDC1 siRNA inquire 50 € abbex human
abx919551 Anti-HKDC1 siRNA 30 nmol 717 € abbex human
LV181594 HKDC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV181595 HKDC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV181596 HKDC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV181597 HKDC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV181599 HKDC1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV181598 HKDC1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human
GWB-6B2DC9 antibody to or anti- Control Immune Serum goat antibody to or anti- peptide sequence Carrier antibody 1 tube 729 € genways human
GWB-BE9688 antibody to or anti- Estrone-6 antibody antibody 1 vial 1041 € genways human
GWB-4AF2C3 antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 x 1 vial 1104 € genways human
GWB-535489 antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 x 1 vial 786 € genways human
GWB-90430B antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 vial 983 € genways human
GWB-A0527F antibody to or anti- Goat antibody to or anti-S-Tag antibody 1 vial 602 € genways human
GWB-4F4BE7 antibody to or anti- Goat antibody to or anti-Type I Collagen antibody 1 x 1 vial 920 € genways human
GWB-C8DE8D antibody to or anti- Goat antibody to or anti-Type I Collagen antibody 1 vial 694 € genways human
GWB-388880 antibody to or anti- Goat antibody to or anti-Type II Collagen antibody 1 x 1 vial 920 € genways human
GWB-E202A8 antibody to or anti- Goat antibody to or anti-Type II Collagen antibody 1 vial 694 € genways human
GWB-6573A5 antibody to or anti- Goat antibody to or anti-Type III Collagen antibody 1 tube 920 € genways human
GWB-B806B3 antibody to or anti- Goat antibody to or anti-Type III Collagen antibody 1 vial 694 € genways human
GWB-35186F antibody to or anti- Goat antibody to or anti-Type IV Collagen antibody 1 x 1 vial 932 € genways human