NONO Antibody / p54nrb

Contact us
Catalog number: R32235
Price: 406 €
Supplier: NJS poly
Product name: NONO Antibody / p54nrb
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: NONO / p54nrb
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the p54nrb antibody should be determined by the researcher
Intented use: This p54nrb antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q15233
Purity: Antigen affinity
Description: A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma, Alternatively spliced transcript variants have been described, Pseudogenes exist on Chromosomes 2 and 16, This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing, Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene
Immunogen: Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ of human NONO/p54nrb were used as the immunogen for the p54nrb antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the p54nrb antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: NONO / p54nrb
Short name: NONO Antibody / p54nrb
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: NONO (Antibody to) / p54nrb
Alternative technique: antibodies
Identity: 7871
Gene: NONO | More about : NONO
Long gene name: non-POU domain containing, octamer-binding
Synonyms gene name: non-POU-domain-containing, octamer-binding
Synonyms: NRB54 NMT55 P54NRB P54 PPP1R114
Synonyms name: 54-kD non-Pou domain-containing octamer (ATGCAAAT) binding protein protein phosphatase 1, Nuclear RNA-binding protein, regulatory subunit 114
Locus: Xq13, 1
Discovery year: 1992-02-06
GenBank acession: L14599
Entrez gene record: 4841
Pubmed identfication: 8371983 9360842
RefSeq identity: NM_007363
Classification: Protein phosphatase 1 regulatory subunits RNA binding motif containing
Havana BLAST/BLAT: OTTHUMG00000021798

Related Products :