| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
NONO / p54nrb |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the p54nrb antibody should be determined by the researcher |
| Intented use: |
This p54nrb antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q15233 |
| Purity: |
Antigen affinity |
| Description: |
A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma, Alternatively spliced transcript variants have been described, Pseudogenes exist on Chromosomes 2 and 16, This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing, Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene |
| Immunogen: |
Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ of human NONO/p54nrb were used as the immunogen for the p54nrb antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the p54nrb antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
NONO / p54nrb |
| Short name: |
NONO Antibody / p54nrb |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
NONO (Antibody to) / p54nrb |
| Alternative technique: |
antibodies |
| Identity: |
7871 |
| Gene: |
NONO |
More about : NONO |
| Long gene name: |
non-POU domain containing, octamer-binding |
| Synonyms gene name: |
non-POU-domain-containing, octamer-binding |
| Synonyms: |
NRB54 NMT55 P54NRB P54 PPP1R114 |
| Synonyms name: |
54-kD non-Pou domain-containing octamer (ATGCAAAT) binding protein protein phosphatase 1, Nuclear RNA-binding protein, regulatory subunit 114 |
| Locus: |
Xq13, 1 |
| Discovery year: |
1992-02-06 |
| GenBank acession: |
L14599 |
| Entrez gene record: |
4841 |
| Pubmed identfication: |
8371983 9360842 |
| RefSeq identity: |
NM_007363 |
| Classification: |
Protein phosphatase 1 regulatory subunits RNA binding motif containing |
| Havana BLAST/BLAT: |
OTTHUMG00000021798 |