| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RAGE |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the RAGE antibody should be determined by the researcher |
| Intented use: |
This RAGE antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q15109 |
| Purity: |
Antigen affinity |
| Description: |
And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction, It interacts with distinct molecules implicated in homeostasis, Moreover, RAGE is also a central cell surface receptor for amphoterin and EN-RAGE, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and certain diseases such as diabetes and Alzheimer's disease, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment, development and inflammation, The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules |
| Immunogen: |
Amino acids IQDEGIFRCQAMNRNGKETKSNYRVRVYQI of human RAGE were used as the immunogen for the RAGE antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RAGE antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RAGE |
| Short name: |
RAGE Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
RAGE (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
320 |
| Gene: |
AGER |
More about : AGER |
| Long gene name: |
advanced glycosylation end-product specific receptor |
| Synonyms: |
RAGE SCARJ1 |
| Synonyms name: |
receptor for advanced glycation end-products |
| Locus: |
6p21, 32 |
| Discovery year: |
1994-10-17 |
| GenBank acession: |
M91211 |
| Entrez gene record: |
177 |
| Pubmed identfication: |
7713518 |
| RefSeq identity: |
NM_001136 |
| Classification: |
C2-set domain containing Immunoglobulin like domain containing Scavenger receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000031120 |