RAGE Antibody

Contact us
Catalog number: R32232
Price: 525 €
Supplier: MBS Polyclonals
Product name: RAGE Antibody
Quantity: 100ug
Other quantities: 0.08 ml 199€ 0.1mg 389€ 0.1ml 263€ 0.25 ml 569€ 0.4 ml 406€ 1 vial 591€ 100ug 917€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RAGE
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the RAGE antibody should be determined by the researcher
Intented use: This RAGE antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q15109
Purity: Antigen affinity
Description: And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction, It interacts with distinct molecules implicated in homeostasis, Moreover, RAGE is also a central cell surface receptor for amphoterin and EN-RAGE, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and certain diseases such as diabetes and Alzheimer's disease, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment, development and inflammation, The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules
Immunogen: Amino acids IQDEGIFRCQAMNRNGKETKSNYRVRVYQI of human RAGE were used as the immunogen for the RAGE antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RAGE antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RAGE
Short name: RAGE Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: RAGE (Antibody to)
Alternative technique: antibodies
Identity: 320
Gene: AGER | More about : AGER
Long gene name: advanced glycosylation end-product specific receptor
Synonyms: RAGE SCARJ1
Synonyms name: receptor for advanced glycation end-products
Locus: 6p21, 32
Discovery year: 1994-10-17
GenBank acession: M91211
Entrez gene record: 177
Pubmed identfication: 7713518
RefSeq identity: NM_001136
Classification: C2-set domain containing Immunoglobulin like domain containing Scavenger receptors
Havana BLAST/BLAT: OTTHUMG00000031120

Related Products :

GWB-D7066A antibody to or anti- RAGE C-terminusinal antibody 1 vial 1168 € genways human
GWB-F936C7 antibody to or anti- RAGE C-terminusinal Human antibody 1 vial 729 € genways human
GWB-A1E2A9 antibody to or anti- Receptor for Advanced Glycosylation End reagents (RAGE) antibody 1 vial 729 € genways human
GWB-BBP091 Polyclonal antibody to or anti-AGER (RAGE) antibody 1 vial 463 € genways human
MBS247493 Anti-Human AGER / RAGE Antibody 50ug 597 € MBS Polyclonals_1 human
BB-EK0827 anti-Human Rage ELISA Kit Antibody 96 Tests 804 € acr human
AP02803SU-N anti-RAGE / AGER (42-59) Antibody 0,1 ml 833 € acr human
SP1305 anti-RAGE / AGER (42-59) Antibody 0,1 ml 688 € acr human
AP23365PU-N anti-RAGE / AGER Antibody 0,2 ml 543 € acr human
BB-PA1069 anti-RAGE / AGER Antibody 0,1 mg 471 € acr human
DM3593P anti-RAGE / AGER (Extracell. Dom.) Antibody 0,1 mg 688 € acr human
AP00826SU-N anti-RAGE / AGER (N-term) Antibody 0,2 ml 529 € acr human
AP12168PU-N anti-RAGE / AGER (N-term) Antibody 0,4 ml 587 € acr human
AP20575PU-N anti-RAGE Antibody 0,1 mg 558 € acr human
C11907-1 anti-RAGE Antibody 50 Вµg 347 € acr human
C11907-2 anti-RAGE Antibody 0,1 mg 500 € acr human
CPA1983-100ul anti-RAGE Antibody 0,1 ml 442 € acr human
CPA1983-200ul anti-RAGE Antibody 0,2 ml 688 € acr human
CPA1983-30ul anti-RAGE Antibody 30 Вµl 326 € acr human
GENTAUR-58be090b78bac Anti- RAGE Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be090bc7e58 Anti- RAGE Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be444ba689f Anti- RAGE Antibody 100ug 393 € MBS Polyclonals human
GT15030-100 anti-RAGE Antibody 0,1 mg 703 € acr human
MO15029-500 anti-RAGE Antibody 0,5 mg 645 € acr human
abx216907 Anti-RAGE Antibody inquire 50 € abbex human
AP14180PU-N anti-RAGE (C-term) Antibody 0,4 ml 587 € acr human
AP17699PU-N anti-RAGE (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58bdd09045842 Anti- Renal Tumor Antigen (RAGE) Antibody 50ug 288 € MBS Polyclonals human
GENTAUR-58bdd0909d6a8 Anti- Renal Tumor Antigen (RAGE) Antibody 100ug 343 € MBS Polyclonals human
GENTAUR-58bdd26e95776 Anti- Renal Tumor Antigen (RAGE) Antibody 100ug 525 € MBS Polyclonals human