| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
NKCC2 / SLC12A1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SLC12A1 antibody should be determined by the researcher |
| Intented use: |
This SLC12A1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q13621 |
| Purity: |
Antigen affinity |
| Description: |
It is sensitive to such diuretics as furosemide and bumetanide, It plays a key role in concentrating urine and accounts for most of the NaCl resorption, Some Bartter-like syndromes result from defects in this gene, This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa, This gene is mapped to 15q21, This gene plays a vital role in the regulation of ionic balance and cell volume, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, member 1, the basic functional units of the kidney, 1, Solute carrier family 12 (sodium/potassium/chloride transporters) |
| Immunogen: |
Amino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1 were used as the immunogen for the SLC12A1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SLC12A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Membrane |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
NKCC2 / SLC12A1 |
| Short name: |
NKCC2 Antibody / SLC12A1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
NKCC2 (Antibody to) / SLC12A1 |
| Alternative technique: |
antibodies |
| Identity: |
10910 |
| Gene: |
SLC12A1 |
More about : SLC12A1 |
| Long gene name: |
solute carrier family 12 member 1 |
| Synonyms gene name: |
member 1 , solute carrier family 12 (sodium/potassium/chloride transporter) |
| Synonyms: |
NKCC2 |
| Locus: |
15q21, 1 |
| Discovery year: |
1994-02-16 |
| Entrez gene record: |
6557 |
| Pubmed identfication: |
8640224 |
| Classification: |
Solute carriers |
| Havana BLAST/BLAT: |
OTTHUMG00000131495 |