NKCC2 Antibody / SLC12A1

Contact us
Catalog number: R32222
Price: 1569 €
Supplier: MBS Recombinant Proteins
Product name: NKCC2 Antibody / SLC12A1
Quantity: 1000ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: NKCC2 / SLC12A1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SLC12A1 antibody should be determined by the researcher
Intented use: This SLC12A1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q13621
Purity: Antigen affinity
Description: It is sensitive to such diuretics as furosemide and bumetanide, It plays a key role in concentrating urine and accounts for most of the NaCl resorption, Some Bartter-like syndromes result from defects in this gene, This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa, This gene is mapped to 15q21, This gene plays a vital role in the regulation of ionic balance and cell volume, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, member 1, the basic functional units of the kidney, 1, Solute carrier family 12 (sodium/potassium/chloride transporters)
Immunogen: Amino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1 were used as the immunogen for the SLC12A1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SLC12A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Membrane
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: NKCC2 / SLC12A1
Short name: NKCC2 Antibody / SLC12A1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: NKCC2 (Antibody to) / SLC12A1
Alternative technique: antibodies
Identity: 10910
Gene: SLC12A1 | More about : SLC12A1
Long gene name: solute carrier family 12 member 1
Synonyms gene name: member 1 , solute carrier family 12 (sodium/potassium/chloride transporter)
Synonyms: NKCC2
Locus: 15q21, 1
Discovery year: 1994-02-16
Entrez gene record: 6557
Pubmed identfication: 8640224
Classification: Solute carriers
Havana BLAST/BLAT: OTTHUMG00000131495

Related Products :

MBS244408 Goat Polyclonal to Human SLC12A1 / NKCC2 Antibody 50ug 597 € MBS Polyclonals_1 human
R31289 NKCC2 Antibody (SLC12A1) 0.1mg 389 € NJS poly human
R32222 NKCC2 Antibody / SLC12A1 0.1mg 406 € NJS poly human
abx129188 Anti-NKCC2 Antibody 10 μg 282 € abbex human
MBS611751 NKCC2 (Sodium, Potassium, Chloride Cotransporter 2, BSC1, CCC2) Antibody 50ug 492 € MBS Polyclonals_1 human
MBS615157 NKCC2 (Sodium, Potassium, Chloride Cotransporter 2, BSC1, CCC2) Antibody 0.05 ml 475 € MBS Polyclonals_1 human
abx575668 Anti-Human Na-K-Cl Cotransporter 2 (NKCC2) ELISA Kit 96 tests 789 € abbex human
abx152529 Anti-Human NKCC2 ELISA Kit 96 tests 934 € abbex human
abx167070 Anti-NKCC2 Protein (Recombinant) 50 μg 615 € abbex human
DL-NKCC2-Hu Human Na-K-Cl Cotransporter 2 NKCC2 ELISA Kit 96T 904 € DL elisas human
EKU06150 Na-K-Cl Cotransporter 2 (NKCC2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
NKCC21-A Rabbit Anti-Rat Na-K-Cl Cotransporters 2 (NKCC2/BSC1) 100 μg 565 € adi rat
NKCC21-S Rabbit Anti-Rat Rat Na-K-Cl Cotransporters 2 (NKCC2/BSC1) antiserum #1 100 μL 536 € adi rat
NKCC21-P Rat Na-K-Cl Cotransporters 2 (NKCC2/BSC1) Control/blocking peptide #1 100 μg 188 € adi rat
AP10171PU-N anti-SLC12A1 (33-55) Antibody 0,1 mg 659 € acr human
AP23996PU-N anti-SLC12A1 (43-57) Antibody 50 Вµg 732 € acr human
GENTAUR-58bdeed3c5a6d Anti- SLC12A1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdeed43dd60 Anti- SLC12A1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be424862c77 Anti- SLC12A1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be4dd7237b7 Anti- SLC12A1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be4dd75c4d8 Anti- SLC12A1 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be4dd7b0b43 Anti- SLC12A1 Antibody 100ug 387 € MBS Polyclonals human
NKCC2-101AP anti-SLC12A1 Antibody 100 µg 357 € fabgen human
NKCC2-BIOTIN anti-SLC12A1 Antibody BIOTIN 100 µg 456 € fabgen human
NKCC2-FITC anti-SLC12A1 Antibody FITC 100 µg 456 € fabgen human
AP10171CP-N anti-SLC12A1 control peptide Antibody 0,25 mg 413 € acr human
GWB-BFFC29 SLC12A1 antibody 1 vial 486 € genways human
abx933509 Anti-SLC12A1 siRNA 30 nmol 717 € abbex human
abx933510 Anti-SLC12A1 siRNA inquire 50 € abbex human
GENTAUR-58b9a5b5b236c Rat Solute carrier family 12 member 1 (Slc12a1), partial 1000ug 1569 € MBS Recombinant Proteins rat