| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
IRF5 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the IRF5 antibody should be determined by the researcher |
| Intented use: |
This IRF5 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q13568 |
| Purity: |
Antigen affinity |
| Description: |
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, also called IRF5 or SLEB10, and immune system activity, and modulation of cell growth, apoptosis, differentiation, including virus-mediated activation of interferon, is a protein that in humans is encoded by the IRF5 gene, Interferon regulatory factor 5 |
| Immunogen: |
Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IRF5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
IRF5 |
| Short name: |
IRF5 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
interferon regulatory factor 5 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0032494 and response to peptidoglycan and biological process this GO :0032495 and response to muramyl dipeptide and biological process this GO :0032727 and positive regulation of interferon-alpha production and biological process this GO :0032728 and positive regulation of interferon-beta production and biological process this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0051607 and defense response to virus and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060337 and type I interferon signaling pathway and biological process, IRF5 and IDBG-40393 and ENSG00000128604 and 3663, IRF5 and IDBG-635292 and ENSBTAG00000004989 and 615340, Irf5 and IDBG-132026 and ENSMUSG00000029771 and 27056, SLEB10, nuclei, protein binding, this GO :0000975 and regulatory region DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000975 : regulatory region DNA binding, this GO :0000975 : regulatory region DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, interferon regulatory factor 5 |
| Identity: |
6120 |
| Gene: |
IRF5 |
More about : IRF5 |
| Long gene name: |
interferon regulatory factor 5 |
| Locus: |
7q32, 1 |
| Discovery year: |
1996-05-31 |
| Entrez gene record: |
3663 |
| RefSeq identity: |
NM_001098627 |
| Havana BLAST/BLAT: |
OTTHUMG00000158410 |